BLASTX nr result
ID: Rehmannia27_contig00031492
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00031492 (737 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO53259.1| hypothetical protein CISIN_1g011392mg [Citrus sin... 70 2e-10 emb|CAN72381.1| hypothetical protein VITISV_038019 [Vitis vinifera] 69 7e-10 ref|XP_002279219.1| PREDICTED: auxin transporter-like protein 2 ... 69 7e-10 gb|AEQ61904.1| auxin influx transport protein [Salvia miltiorrhiza] 69 8e-10 dbj|BAH47613.1| auxin influx carrier protein [Zinnia violacea] 68 1e-09 gb|KVI11506.1| Amino acid transporter, transmembrane [Cynara car... 67 2e-09 ref|XP_006379625.1| hypothetical protein POPTR_0008s06630g [Popu... 67 2e-09 ref|XP_012832149.1| PREDICTED: auxin transporter-like protein 2 ... 67 2e-09 gb|KDO53258.1| hypothetical protein CISIN_1g011392mg [Citrus sin... 67 3e-09 gb|KDO53257.1| hypothetical protein CISIN_1g011392mg [Citrus sin... 67 3e-09 ref|XP_012832145.1| PREDICTED: auxin transporter-like protein 2 ... 66 5e-09 ref|XP_006349465.1| PREDICTED: auxin transporter-like protein 4 ... 66 5e-09 gb|EYU26651.1| hypothetical protein MIMGU_mgv1a0066981mg, partia... 65 7e-09 ref|XP_012850162.1| PREDICTED: auxin transporter-like protein 2 ... 65 1e-08 ref|XP_012847973.1| PREDICTED: auxin transporter-like protein 2 ... 65 1e-08 ref|NP_001151566.1| auxin transporter-like protein 1 [Zea mays] ... 65 1e-08 ref|XP_004970626.1| PREDICTED: auxin transporter-like protein 1 ... 65 1e-08 ref|XP_008673001.1| PREDICTED: auxin transporter-like protein 1 ... 65 1e-08 ref|XP_009122846.1| PREDICTED: auxin transporter-like protein 1 ... 65 1e-08 ref|XP_009122845.1| PREDICTED: auxin transporter-like protein 1 ... 65 1e-08 >gb|KDO53259.1| hypothetical protein CISIN_1g011392mg [Citrus sinensis] Length = 347 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +1 Query: 1 FGDQLLNHSNAFSLLPKTRWRDAAVVLMLIHQVSLLF 111 FGDQLLNHSNAFSLLPK RWRDAAV+LMLIHQV F Sbjct: 295 FGDQLLNHSNAFSLLPKNRWRDAAVILMLIHQVQFQF 331 >emb|CAN72381.1| hypothetical protein VITISV_038019 [Vitis vinifera] Length = 478 Score = 68.6 bits (166), Expect = 7e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 FGDQLLNHSNAFSLLPKTRWRDAAVVLMLIHQ 96 FGDQLLNHSNAFSLLPKTRWRDAAV+LMLIHQ Sbjct: 288 FGDQLLNHSNAFSLLPKTRWRDAAVILMLIHQ 319 >ref|XP_002279219.1| PREDICTED: auxin transporter-like protein 2 [Vitis vinifera] gi|297740231|emb|CBI30413.3| unnamed protein product [Vitis vinifera] Length = 478 Score = 68.6 bits (166), Expect = 7e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 FGDQLLNHSNAFSLLPKTRWRDAAVVLMLIHQ 96 FGDQLLNHSNAFSLLPKTRWRDAAV+LMLIHQ Sbjct: 288 FGDQLLNHSNAFSLLPKTRWRDAAVILMLIHQ 319 >gb|AEQ61904.1| auxin influx transport protein [Salvia miltiorrhiza] Length = 487 Score = 68.6 bits (166), Expect = 8e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 FGDQLLNHSNAFSLLPKTRWRDAAVVLMLIHQ 96 FGDQLLNHSNAFSLLPKTRWRDAAV+LMLIHQ Sbjct: 294 FGDQLLNHSNAFSLLPKTRWRDAAVILMLIHQ 325 >dbj|BAH47613.1| auxin influx carrier protein [Zinnia violacea] Length = 471 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +1 Query: 1 FGDQLLNHSNAFSLLPKTRWRDAAVVLMLIHQ 96 FGD+LLNHSNAFSLLPKTRWRDAAVVLMLIHQ Sbjct: 285 FGDELLNHSNAFSLLPKTRWRDAAVVLMLIHQ 316 >gb|KVI11506.1| Amino acid transporter, transmembrane [Cynara cardunculus var. scolymus] Length = 500 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 1 FGDQLLNHSNAFSLLPKTRWRDAAVVLMLIHQ 96 FGD+LLNHSNAFSLLPKTRWRDAAV+LMLIHQ Sbjct: 314 FGDELLNHSNAFSLLPKTRWRDAAVILMLIHQ 345 >ref|XP_006379625.1| hypothetical protein POPTR_0008s06630g [Populus trichocarpa] gi|550332559|gb|ERP57422.1| hypothetical protein POPTR_0008s06630g [Populus trichocarpa] Length = 332 Score = 66.6 bits (161), Expect = 2e-09 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = +1 Query: 1 FGDQLLNHSNAFSLLPKTRWRDAAVVLMLIHQVSLLFFHLWCSII 135 FGDQLL HSNAFSLLP+T WRDAAV+LMLIHQV LFF S+I Sbjct: 286 FGDQLLTHSNAFSLLPRTPWRDAAVILMLIHQV--LFFFCIFSVI 328 >ref|XP_012832149.1| PREDICTED: auxin transporter-like protein 2 [Erythranthe guttata] gi|604342851|gb|EYU41875.1| hypothetical protein MIMGU_mgv1a005679mg [Erythranthe guttata] Length = 474 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 1 FGDQLLNHSNAFSLLPKTRWRDAAVVLMLIHQ 96 FGDQLLNHSNAFSLLPKTRWRDAAV+L+LIHQ Sbjct: 289 FGDQLLNHSNAFSLLPKTRWRDAAVILILIHQ 320 >gb|KDO53258.1| hypothetical protein CISIN_1g011392mg [Citrus sinensis] Length = 438 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 FGDQLLNHSNAFSLLPKTRWRDAAVVLMLIHQ 96 FGDQLLNHSNAFSLLPK RWRDAAV+LMLIHQ Sbjct: 295 FGDQLLNHSNAFSLLPKNRWRDAAVILMLIHQ 326 >gb|KDO53257.1| hypothetical protein CISIN_1g011392mg [Citrus sinensis] Length = 487 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 FGDQLLNHSNAFSLLPKTRWRDAAVVLMLIHQ 96 FGDQLLNHSNAFSLLPK RWRDAAV+LMLIHQ Sbjct: 295 FGDQLLNHSNAFSLLPKNRWRDAAVILMLIHQ 326 >ref|XP_012832145.1| PREDICTED: auxin transporter-like protein 2 [Erythranthe guttata] gi|604342848|gb|EYU41872.1| hypothetical protein MIMGU_mgv1a005485mg [Erythranthe guttata] Length = 482 Score = 66.2 bits (160), Expect = 5e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 FGDQLLNHSNAFSLLPKTRWRDAAVVLMLIHQ 96 FGDQLLNHSNAFSLLPKT WRDAAV+LMLIHQ Sbjct: 292 FGDQLLNHSNAFSLLPKTAWRDAAVILMLIHQ 323 >ref|XP_006349465.1| PREDICTED: auxin transporter-like protein 4 [Solanum tuberosum] Length = 485 Score = 66.2 bits (160), Expect = 5e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 FGDQLLNHSNAFSLLPKTRWRDAAVVLMLIHQ 96 FGDQLLNHSNAFSLLPK RWRDAAV+LMLIHQ Sbjct: 291 FGDQLLNHSNAFSLLPKDRWRDAAVILMLIHQ 322 >gb|EYU26651.1| hypothetical protein MIMGU_mgv1a0066981mg, partial [Erythranthe guttata] Length = 310 Score = 65.1 bits (157), Expect = 7e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 FGDQLLNHSNAFSLLPKTRWRDAAVVLMLIHQ 96 FGDQLLNHSNAFSLLPK+ WRDAAVVLMLIHQ Sbjct: 121 FGDQLLNHSNAFSLLPKSAWRDAAVVLMLIHQ 152 >ref|XP_012850162.1| PREDICTED: auxin transporter-like protein 2 [Erythranthe guttata] Length = 447 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 FGDQLLNHSNAFSLLPKTRWRDAAVVLMLIHQ 96 FGDQLLNHSNAFSLLPK+ WRDAAVVLMLIHQ Sbjct: 258 FGDQLLNHSNAFSLLPKSAWRDAAVVLMLIHQ 289 >ref|XP_012847973.1| PREDICTED: auxin transporter-like protein 2 [Erythranthe guttata] gi|604315934|gb|EYU28490.1| hypothetical protein MIMGU_mgv1a005429mg [Erythranthe guttata] Length = 484 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 FGDQLLNHSNAFSLLPKTRWRDAAVVLMLIHQ 96 FGDQLLNHSNAFSLLPK+ WRDAAVVLMLIHQ Sbjct: 295 FGDQLLNHSNAFSLLPKSAWRDAAVVLMLIHQ 326 >ref|NP_001151566.1| auxin transporter-like protein 1 [Zea mays] gi|195647796|gb|ACG43366.1| auxin transporter-like protein 1 [Zea mays] Length = 490 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 1 FGDQLLNHSNAFSLLPKTRWRDAAVVLMLIHQ 96 FGD+LL HSNAFSLLPKTRWRDAAV+LMLIHQ Sbjct: 296 FGDELLTHSNAFSLLPKTRWRDAAVILMLIHQ 327 >ref|XP_004970626.1| PREDICTED: auxin transporter-like protein 1 [Setaria italica] gi|835982578|ref|XP_012701872.1| PREDICTED: auxin transporter-like protein 1 [Setaria italica] gi|944243493|gb|KQL07801.1| hypothetical protein SETIT_004876mg [Setaria italica] Length = 490 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 1 FGDQLLNHSNAFSLLPKTRWRDAAVVLMLIHQ 96 FGD+LLNHSNAFSLLPKT WRDAAV+LMLIHQ Sbjct: 296 FGDELLNHSNAFSLLPKTAWRDAAVILMLIHQ 327 >ref|XP_008673001.1| PREDICTED: auxin transporter-like protein 1 isoform X1 [Zea mays] gi|414879637|tpg|DAA56768.1| TPA: auxin transporter-like protein 1 isoform 1 [Zea mays] gi|414879638|tpg|DAA56769.1| TPA: auxin transporter-like protein 1 isoform 2 [Zea mays] gi|414879639|tpg|DAA56770.1| TPA: auxin transporter-like protein 1 isoform 3 [Zea mays] gi|414879640|tpg|DAA56771.1| TPA: auxin transporter-like protein 1 isoform 4 [Zea mays] Length = 490 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 1 FGDQLLNHSNAFSLLPKTRWRDAAVVLMLIHQ 96 FGD+LL HSNAFSLLPKTRWRDAAV+LMLIHQ Sbjct: 296 FGDELLTHSNAFSLLPKTRWRDAAVILMLIHQ 327 >ref|XP_009122846.1| PREDICTED: auxin transporter-like protein 1 isoform X3 [Brassica rapa] gi|923924892|ref|XP_013731487.1| PREDICTED: auxin transporter-like protein 1 [Brassica napus] Length = 411 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 1 FGDQLLNHSNAFSLLPKTRWRDAAVVLMLIHQ 96 FGDQLLNHSNAFSLLPKTR+RDAAV+LMLIHQ Sbjct: 217 FGDQLLNHSNAFSLLPKTRFRDAAVILMLIHQ 248 >ref|XP_009122845.1| PREDICTED: auxin transporter-like protein 1 isoform X2 [Brassica rapa] Length = 438 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 1 FGDQLLNHSNAFSLLPKTRWRDAAVVLMLIHQ 96 FGDQLLNHSNAFSLLPKTR+RDAAV+LMLIHQ Sbjct: 244 FGDQLLNHSNAFSLLPKTRFRDAAVILMLIHQ 275