BLASTX nr result
ID: Rehmannia27_contig00031267
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00031267 (360 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081830.1| PREDICTED: GTP-binding protein At2g22870 [Se... 97 5e-22 ref|XP_007012043.1| P-loop containing nucleoside triphosphate hy... 96 1e-21 ref|XP_010519913.1| PREDICTED: GTP-binding protein At2g22870 [Ta... 95 3e-21 ref|XP_006450618.1| hypothetical protein CICLE_v10009000mg [Citr... 94 5e-21 emb|CDP16152.1| unnamed protein product [Coffea canephora] 94 1e-20 ref|XP_015885160.1| PREDICTED: GTP-binding protein At2g22870 [Zi... 94 1e-20 ref|XP_012077454.1| PREDICTED: GTP-binding protein At2g22870 [Ja... 93 2e-20 gb|KYP65190.1| GTP-binding protein At2g22870 family [Cajanus cajan] 93 2e-20 ref|XP_015945896.1| PREDICTED: GTP-binding protein At2g22870 [Ar... 93 2e-20 ref|XP_010112169.1| GTP-binding protein [Morus notabilis] gi|587... 92 3e-20 gb|KHN10234.1| GTP-binding protein [Glycine soja] 92 4e-20 ref|XP_006581419.1| PREDICTED: GTP-binding protein At2g22870-lik... 92 4e-20 ref|XP_003522687.1| PREDICTED: GTP-binding protein At2g22870-lik... 92 4e-20 ref|XP_007137167.1| hypothetical protein PHAVU_009G105600g [Phas... 92 5e-20 ref|XP_012450891.1| PREDICTED: GTP-binding protein At2g22870 [Go... 92 6e-20 gb|KHG18361.1| GTP-binding -like protein [Gossypium arboreum] 92 6e-20 ref|XP_015085448.1| PREDICTED: GTP-binding protein At2g22870 [So... 92 6e-20 ref|XP_006356644.1| PREDICTED: GTP-binding protein At2g22870 [So... 92 6e-20 ref|XP_004245257.1| PREDICTED: GTP-binding protein At2g22870 [So... 92 6e-20 gb|KNA21746.1| hypothetical protein SOVF_040430 [Spinacia oleracea] 92 7e-20 >ref|XP_011081830.1| PREDICTED: GTP-binding protein At2g22870 [Sesamum indicum] Length = 325 Score = 97.4 bits (241), Expect = 5e-22 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = -2 Query: 359 QDFQELIRGFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 225 QDFQELIRGFFQTAPPWIMTSSVTNQGR+EILLHMSQLRNYWLKH Sbjct: 281 QDFQELIRGFFQTAPPWIMTSSVTNQGREEILLHMSQLRNYWLKH 325 >ref|XP_007012043.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein isoform 1 [Theobroma cacao] gi|508782406|gb|EOY29662.1| P-loop containing nucleoside triphosphate hydrolases superfamily protein isoform 1 [Theobroma cacao] Length = 311 Score = 95.9 bits (237), Expect = 1e-21 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = -2 Query: 356 DFQELIRGFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 225 DFQELIRGFFQTAPPWIMTSSVTNQGRDEILLHM+QLRNYWLKH Sbjct: 268 DFQELIRGFFQTAPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH 311 >ref|XP_010519913.1| PREDICTED: GTP-binding protein At2g22870 [Tarenaya hassleriana] Length = 318 Score = 95.1 bits (235), Expect = 3e-21 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = -2 Query: 359 QDFQELIRGFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 225 +DFQ+LIRGFF+TAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH Sbjct: 274 KDFQDLIRGFFETAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 318 >ref|XP_006450618.1| hypothetical protein CICLE_v10009000mg [Citrus clementina] gi|568844542|ref|XP_006476147.1| PREDICTED: GTP-binding protein At2g22870 [Citrus sinensis] gi|568844544|ref|XP_006476148.1| PREDICTED: GTP-binding protein At2g22870 [Citrus sinensis] gi|557553844|gb|ESR63858.1| hypothetical protein CICLE_v10009000mg [Citrus clementina] gi|641861020|gb|KDO79708.1| hypothetical protein CISIN_1g021764mg [Citrus sinensis] gi|641861021|gb|KDO79709.1| hypothetical protein CISIN_1g021764mg [Citrus sinensis] gi|641861022|gb|KDO79710.1| hypothetical protein CISIN_1g021764mg [Citrus sinensis] Length = 308 Score = 94.4 bits (233), Expect = 5e-21 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -2 Query: 356 DFQELIRGFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 225 DFQELI+GFFQTAPPWIMTSSVTNQGRDEILLHM+QLRNYWLKH Sbjct: 265 DFQELIQGFFQTAPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH 308 >emb|CDP16152.1| unnamed protein product [Coffea canephora] Length = 322 Score = 93.6 bits (231), Expect = 1e-20 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -2 Query: 359 QDFQELIRGFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 225 Q+FQELIR FFQTAPPWIMTSS+TNQGRDEILLHMSQLRNYWLKH Sbjct: 278 QNFQELIREFFQTAPPWIMTSSITNQGRDEILLHMSQLRNYWLKH 322 >ref|XP_015885160.1| PREDICTED: GTP-binding protein At2g22870 [Ziziphus jujuba] Length = 326 Score = 93.6 bits (231), Expect = 1e-20 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -2 Query: 356 DFQELIRGFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 225 DFQEL+RGFF TAPPWIMTSSVTNQGRDEILLHM+QLRNYWLKH Sbjct: 283 DFQELVRGFFNTAPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH 326 >ref|XP_012077454.1| PREDICTED: GTP-binding protein At2g22870 [Jatropha curcas] gi|802633401|ref|XP_012077455.1| PREDICTED: GTP-binding protein At2g22870 [Jatropha curcas] gi|643725017|gb|KDP34218.1| hypothetical protein JCGZ_07789 [Jatropha curcas] Length = 317 Score = 93.2 bits (230), Expect = 2e-20 Identities = 41/44 (93%), Positives = 44/44 (100%) Frame = -2 Query: 356 DFQELIRGFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 225 DFQELIRGFF+TAPPWIMTSSVTNQGRDEILLH++QLRNYWLKH Sbjct: 274 DFQELIRGFFETAPPWIMTSSVTNQGRDEILLHVAQLRNYWLKH 317 >gb|KYP65190.1| GTP-binding protein At2g22870 family [Cajanus cajan] Length = 300 Score = 92.8 bits (229), Expect = 2e-20 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -2 Query: 356 DFQELIRGFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 225 DFQELIRGFFQ+ PPWIMTSSVTNQGRDEILLHM+QLRNYWLKH Sbjct: 257 DFQELIRGFFQSVPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH 300 >ref|XP_015945896.1| PREDICTED: GTP-binding protein At2g22870 [Arachis duranensis] Length = 315 Score = 92.8 bits (229), Expect = 2e-20 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -2 Query: 356 DFQELIRGFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 225 DFQELI GFF+TAPPWIMTSSVTNQGRDEILLHM+QLRNYWLKH Sbjct: 272 DFQELIHGFFETAPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH 315 >ref|XP_010112169.1| GTP-binding protein [Morus notabilis] gi|587946455|gb|EXC32794.1| GTP-binding protein [Morus notabilis] Length = 304 Score = 92.4 bits (228), Expect = 3e-20 Identities = 40/44 (90%), Positives = 44/44 (100%) Frame = -2 Query: 356 DFQELIRGFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 225 DFQEL+RGFF++APPWIMTSSVTNQGRDEILLHM+QLRNYWLKH Sbjct: 261 DFQELVRGFFKSAPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH 304 >gb|KHN10234.1| GTP-binding protein [Glycine soja] Length = 293 Score = 91.7 bits (226), Expect = 4e-20 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -2 Query: 356 DFQELIRGFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 225 DFQ+LIRGFFQ+ PPWIMTSSVTNQGRDEILLHM+QLRNYWLKH Sbjct: 250 DFQDLIRGFFQSVPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH 293 >ref|XP_006581419.1| PREDICTED: GTP-binding protein At2g22870-like [Glycine max] gi|571459478|ref|XP_006581420.1| PREDICTED: GTP-binding protein At2g22870-like [Glycine max] gi|947104281|gb|KRH52664.1| hypothetical protein GLYMA_06G081500 [Glycine max] Length = 293 Score = 91.7 bits (226), Expect = 4e-20 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -2 Query: 356 DFQELIRGFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 225 DFQ+LIRGFFQ+ PPWIMTSSVTNQGRDEILLHM+QLRNYWLKH Sbjct: 250 DFQDLIRGFFQSVPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH 293 >ref|XP_003522687.1| PREDICTED: GTP-binding protein At2g22870-like [Glycine max] gi|571449670|ref|XP_006578210.1| PREDICTED: GTP-binding protein At2g22870-like [Glycine max] gi|947113706|gb|KRH62008.1| hypothetical protein GLYMA_04G079900 [Glycine max] gi|947113707|gb|KRH62009.1| hypothetical protein GLYMA_04G079900 [Glycine max] Length = 293 Score = 91.7 bits (226), Expect = 4e-20 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -2 Query: 356 DFQELIRGFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 225 DFQ+LIRGFFQ+ PPWIMTSSVTNQGRDEILLHM+QLRNYWLKH Sbjct: 250 DFQDLIRGFFQSVPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH 293 >ref|XP_007137167.1| hypothetical protein PHAVU_009G105600g [Phaseolus vulgaris] gi|561010254|gb|ESW09161.1| hypothetical protein PHAVU_009G105600g [Phaseolus vulgaris] Length = 298 Score = 91.7 bits (226), Expect = 5e-20 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -2 Query: 356 DFQELIRGFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 225 DFQ+LIRGFFQ+ PPWIMTSSVTNQGRDEILLHM+QLRNYWLKH Sbjct: 255 DFQDLIRGFFQSVPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH 298 >ref|XP_012450891.1| PREDICTED: GTP-binding protein At2g22870 [Gossypium raimondii] gi|763798748|gb|KJB65703.1| hypothetical protein B456_010G109600 [Gossypium raimondii] Length = 311 Score = 91.7 bits (226), Expect = 6e-20 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -2 Query: 359 QDFQELIRGFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 225 +DFQELI GFFQT PPWIMTSSVTNQGRDEILLHM+QLRNYWLKH Sbjct: 267 KDFQELICGFFQTVPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH 311 >gb|KHG18361.1| GTP-binding -like protein [Gossypium arboreum] Length = 311 Score = 91.7 bits (226), Expect = 6e-20 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -2 Query: 359 QDFQELIRGFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 225 +DFQELI GFFQT PPWIMTSSVTNQGRDEILLHM+QLRNYWLKH Sbjct: 267 KDFQELICGFFQTVPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH 311 >ref|XP_015085448.1| PREDICTED: GTP-binding protein At2g22870 [Solanum pennellii] Length = 319 Score = 91.7 bits (226), Expect = 6e-20 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -2 Query: 359 QDFQELIRGFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 225 QDF ELI+ FFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH Sbjct: 275 QDFLELIQKFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 319 >ref|XP_006356644.1| PREDICTED: GTP-binding protein At2g22870 [Solanum tuberosum] Length = 319 Score = 91.7 bits (226), Expect = 6e-20 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -2 Query: 359 QDFQELIRGFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 225 QDF ELI+ FFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH Sbjct: 275 QDFLELIQKFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 319 >ref|XP_004245257.1| PREDICTED: GTP-binding protein At2g22870 [Solanum lycopersicum] Length = 319 Score = 91.7 bits (226), Expect = 6e-20 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -2 Query: 359 QDFQELIRGFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 225 QDF ELI+ FFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH Sbjct: 275 QDFLELIQKFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 319 >gb|KNA21746.1| hypothetical protein SOVF_040430 [Spinacia oleracea] Length = 329 Score = 91.7 bits (226), Expect = 7e-20 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = -2 Query: 359 QDFQELIRGFFQTAPPWIMTSSVTNQGRDEILLHMSQLRNYWLKH 225 QDFQELIR FF+ APPWIMTSSVTNQGRDEILLHM+QLRNYWLKH Sbjct: 285 QDFQELIREFFEAAPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH 329