BLASTX nr result
ID: Rehmannia27_contig00031074
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00031074 (386 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012853142.1| PREDICTED: pentatricopeptide repeat-containi... 94 6e-20 ref|XP_012840386.1| PREDICTED: pentatricopeptide repeat-containi... 94 6e-20 ref|XP_012854029.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-17 ref|XP_011087317.1| PREDICTED: pentatricopeptide repeat-containi... 75 3e-13 ref|XP_011087320.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-09 ref|XP_011087319.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-09 >ref|XP_012853142.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Erythranthe guttata] gi|848908341|ref|XP_012853143.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Erythranthe guttata] Length = 999 Score = 94.0 bits (232), Expect = 6e-20 Identities = 45/64 (70%), Positives = 54/64 (84%), Gaps = 1/64 (1%) Frame = +2 Query: 197 TTHFVFTDLMGCDFA-FQMRNSPQTVINGILSTFHGVPRRCSTFFPSKNCILYSLGFRSS 373 T+ F+FTD+MGCDF QMR+ P+ V+ GILSTF GV RRCSTF+P+KN +LYSLGFRSS Sbjct: 2 TSRFLFTDVMGCDFVTMQMRSPPRIVVEGILSTFCGVHRRCSTFYPTKNHLLYSLGFRSS 61 Query: 374 FSTA 385 FSTA Sbjct: 62 FSTA 65 >ref|XP_012840386.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Erythranthe guttata] gi|848880003|ref|XP_012840387.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Erythranthe guttata] Length = 999 Score = 94.0 bits (232), Expect = 6e-20 Identities = 45/64 (70%), Positives = 54/64 (84%), Gaps = 1/64 (1%) Frame = +2 Query: 197 TTHFVFTDLMGCDFA-FQMRNSPQTVINGILSTFHGVPRRCSTFFPSKNCILYSLGFRSS 373 T+ F+FTD+MGCDF QMR+ P+ V+ GILSTF GV RRCSTF+P+KN +LYSLGFRSS Sbjct: 2 TSRFLFTDVMGCDFVTMQMRSPPRIVVEGILSTFCGVHRRCSTFYPTKNHLLYSLGFRSS 61 Query: 374 FSTA 385 FSTA Sbjct: 62 FSTA 65 >ref|XP_012854029.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Erythranthe guttata] Length = 999 Score = 86.7 bits (213), Expect = 2e-17 Identities = 42/64 (65%), Positives = 52/64 (81%), Gaps = 1/64 (1%) Frame = +2 Query: 197 TTHFVFTDLMGCDF-AFQMRNSPQTVINGILSTFHGVPRRCSTFFPSKNCILYSLGFRSS 373 T+ F+FTD+MGCDF + QMR+ P+ V+ GILS F GV R CSTF+P+KN +L SLGFRSS Sbjct: 2 TSRFLFTDVMGCDFVSMQMRSPPRIVVEGILSNFCGVHRMCSTFYPTKNHLLCSLGFRSS 61 Query: 374 FSTA 385 FSTA Sbjct: 62 FSTA 65 >ref|XP_011087317.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X1 [Sesamum indicum] gi|747080154|ref|XP_011087318.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X1 [Sesamum indicum] Length = 1032 Score = 74.7 bits (182), Expect = 3e-13 Identities = 39/61 (63%), Positives = 43/61 (70%), Gaps = 1/61 (1%) Frame = +2 Query: 206 FVFTDLMGCDFAF-QMRNSPQTVINGILSTFHGVPRRCSTFFPSKNCILYSLGFRSSFST 382 ++ T LMGC FA QMRN PQTV GILSTF GVP RCS F + N + YS G RSSFST Sbjct: 34 YLLTKLMGCHFASSQMRNRPQTVFRGILSTFPGVPGRCSAFSLTNNHLFYSFGSRSSFST 93 Query: 383 A 385 A Sbjct: 94 A 94 >ref|XP_011087320.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X3 [Sesamum indicum] Length = 984 Score = 62.4 bits (150), Expect = 6e-09 Identities = 31/46 (67%), Positives = 33/46 (71%) Frame = +2 Query: 248 MRNSPQTVINGILSTFHGVPRRCSTFFPSKNCILYSLGFRSSFSTA 385 MRN PQTV GILSTF GVP RCS F + N + YS G RSSFSTA Sbjct: 1 MRNRPQTVFRGILSTFPGVPGRCSAFSLTNNHLFYSFGSRSSFSTA 46 >ref|XP_011087319.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X2 [Sesamum indicum] Length = 1003 Score = 62.4 bits (150), Expect = 6e-09 Identities = 31/46 (67%), Positives = 33/46 (71%) Frame = +2 Query: 248 MRNSPQTVINGILSTFHGVPRRCSTFFPSKNCILYSLGFRSSFSTA 385 MRN PQTV GILSTF GVP RCS F + N + YS G RSSFSTA Sbjct: 20 MRNRPQTVFRGILSTFPGVPGRCSAFSLTNNHLFYSFGSRSSFSTA 65