BLASTX nr result
ID: Rehmannia27_contig00031042
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00031042 (581 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096676.1| PREDICTED: BES1/BZR1 homolog protein 4-like ... 72 2e-12 emb|CDP17316.1| unnamed protein product [Coffea canephora] 68 1e-10 emb|CBI31001.3| unnamed protein product [Vitis vinifera] 66 3e-10 ref|XP_012827427.1| PREDICTED: BES1/BZR1 homolog protein 2-like ... 66 5e-10 ref|XP_007022864.1| Beta-amylase 7 [Theobroma cacao] gi|50877823... 66 5e-10 ref|XP_003632998.2| PREDICTED: protein BZR1 homolog 3-like [Viti... 66 6e-10 ref|XP_009783609.1| PREDICTED: beta-amylase 7-like isoform X1 [N... 65 1e-09 ref|XP_004295606.1| PREDICTED: protein BZR1 homolog 2-like [Frag... 62 8e-09 ref|XP_009344419.1| PREDICTED: protein BRASSINAZOLE-RESISTANT 1-... 62 1e-08 ref|XP_008383467.1| PREDICTED: BES1/BZR1 homolog protein 2-like ... 62 1e-08 ref|XP_007212847.1| hypothetical protein PRUPE_ppa020974mg [Prun... 62 1e-08 ref|XP_008225589.1| PREDICTED: BES1/BZR1 homolog protein 4-like ... 62 1e-08 ref|XP_015883179.1| PREDICTED: protein BZR1 homolog 3-like [Zizi... 63 1e-08 gb|KDP34937.1| hypothetical protein JCGZ_09225 [Jatropha curcas] 62 2e-08 ref|XP_002523196.1| PREDICTED: protein BZR1 homolog 4 [Ricinus c... 62 2e-08 ref|XP_010241187.1| PREDICTED: protein BZR1 homolog 3-like [Nelu... 62 2e-08 ref|XP_008373727.1| PREDICTED: protein BZR1 homolog 2-like [Malu... 59 2e-08 ref|XP_012075632.1| PREDICTED: protein BZR1 homolog 3-like [Jatr... 62 3e-08 ref|XP_011038890.1| PREDICTED: BES1/BZR1 homolog protein 4-like ... 60 1e-07 ref|XP_002298893.2| hypothetical protein POPTR_0001s38140g [Popu... 59 2e-07 >ref|XP_011096676.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Sesamum indicum] Length = 190 Score = 72.0 bits (175), Expect = 2e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 104 VRSAVEKERTKMRERQRRSITTNIFHGLRKHGGY 3 VRSAVEKERTKMRERQRRSITTNIFHGLRKHGGY Sbjct: 8 VRSAVEKERTKMRERQRRSITTNIFHGLRKHGGY 41 >emb|CDP17316.1| unnamed protein product [Coffea canephora] Length = 222 Score = 67.8 bits (164), Expect = 1e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -1 Query: 107 AVRSAVEKERTKMRERQRRSITTNIFHGLRKHGGY 3 ++RSAVEKERTK+RERQRRSITT IFHGLRKHGGY Sbjct: 21 SMRSAVEKERTKLRERQRRSITTKIFHGLRKHGGY 55 >emb|CBI31001.3| unnamed protein product [Vitis vinifera] Length = 181 Score = 65.9 bits (159), Expect = 3e-10 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 104 VRSAVEKERTKMRERQRRSITTNIFHGLRKHGGY 3 VRS +KE+TKMRERQRRSITTNIFHGLRKHGGY Sbjct: 29 VRSVSDKEKTKMRERQRRSITTNIFHGLRKHGGY 62 >ref|XP_012827427.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Erythranthe guttata] gi|604299193|gb|EYU19128.1| hypothetical protein MIMGU_mgv1a013909mg [Erythranthe guttata] Length = 207 Score = 65.9 bits (159), Expect = 5e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 101 RSAVEKERTKMRERQRRSITTNIFHGLRKHGGY 3 RSAVEKERTK+RERQRR+ITT IFHGLRKHGGY Sbjct: 19 RSAVEKERTKLRERQRRAITTKIFHGLRKHGGY 51 >ref|XP_007022864.1| Beta-amylase 7 [Theobroma cacao] gi|508778230|gb|EOY25486.1| Beta-amylase 7 [Theobroma cacao] Length = 209 Score = 65.9 bits (159), Expect = 5e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 101 RSAVEKERTKMRERQRRSITTNIFHGLRKHGGY 3 RS +EKERTKMRERQRR+ITTNIFHGLR+HGGY Sbjct: 33 RSEIEKERTKMRERQRRAITTNIFHGLRRHGGY 65 >ref|XP_003632998.2| PREDICTED: protein BZR1 homolog 3-like [Vitis vinifera] Length = 215 Score = 65.9 bits (159), Expect = 6e-10 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 104 VRSAVEKERTKMRERQRRSITTNIFHGLRKHGGY 3 VRS +KE+TKMRERQRRSITTNIFHGLRKHGGY Sbjct: 29 VRSVSDKEKTKMRERQRRSITTNIFHGLRKHGGY 62 >ref|XP_009783609.1| PREDICTED: beta-amylase 7-like isoform X1 [Nicotiana sylvestris] gi|698469596|ref|XP_009783610.1| PREDICTED: beta-amylase 7-like isoform X1 [Nicotiana sylvestris] Length = 231 Score = 65.5 bits (158), Expect = 1e-09 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -1 Query: 122 NNMSTAVRSAVEKERTKMRERQRRSITTNIFHGLRKHGGY 3 +N S RSAVEKE+TKMRERQRR+ITT IF+GLRKHGGY Sbjct: 11 SNNSNGRRSAVEKEKTKMRERQRRAITTKIFNGLRKHGGY 50 >ref|XP_004295606.1| PREDICTED: protein BZR1 homolog 2-like [Fragaria vesca subsp. vesca] Length = 159 Score = 61.6 bits (148), Expect = 8e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 101 RSAVEKERTKMRERQRRSITTNIFHGLRKHGGY 3 RS EKE+TKMRERQRR+ITT IFHGLRKHGGY Sbjct: 9 RSESEKEKTKMRERQRRAITTKIFHGLRKHGGY 41 >ref|XP_009344419.1| PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like [Pyrus x bretschneideri] Length = 167 Score = 61.6 bits (148), Expect = 1e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 101 RSAVEKERTKMRERQRRSITTNIFHGLRKHGGY 3 RS EKE+TKMRERQRR+ITT IFHGLRKHGGY Sbjct: 9 RSESEKEKTKMRERQRRAITTKIFHGLRKHGGY 41 >ref|XP_008383467.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Malus domestica] Length = 171 Score = 61.6 bits (148), Expect = 1e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 101 RSAVEKERTKMRERQRRSITTNIFHGLRKHGGY 3 RS EKE+TKMRERQRR+ITT IFHGLRKHGGY Sbjct: 11 RSESEKEKTKMRERQRRAITTKIFHGLRKHGGY 43 >ref|XP_007212847.1| hypothetical protein PRUPE_ppa020974mg [Prunus persica] gi|462408712|gb|EMJ14046.1| hypothetical protein PRUPE_ppa020974mg [Prunus persica] Length = 171 Score = 61.6 bits (148), Expect = 1e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 101 RSAVEKERTKMRERQRRSITTNIFHGLRKHGGY 3 RS EKE+TKMRERQRR+ITT IFHGLRKHGGY Sbjct: 7 RSESEKEKTKMRERQRRAITTKIFHGLRKHGGY 39 >ref|XP_008225589.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Prunus mume] Length = 175 Score = 61.6 bits (148), Expect = 1e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 101 RSAVEKERTKMRERQRRSITTNIFHGLRKHGGY 3 RS EKE+TKMRERQRR+ITT IFHGLRKHGGY Sbjct: 7 RSESEKEKTKMRERQRRAITTKIFHGLRKHGGY 39 >ref|XP_015883179.1| PREDICTED: protein BZR1 homolog 3-like [Ziziphus jujuba] Length = 258 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 101 RSAVEKERTKMRERQRRSITTNIFHGLRKHGGY 3 RS +KE+TKMRERQRR+ITTNIFHGLRKHGGY Sbjct: 82 RSQSDKEKTKMRERQRRAITTNIFHGLRKHGGY 114 >gb|KDP34937.1| hypothetical protein JCGZ_09225 [Jatropha curcas] Length = 218 Score = 61.6 bits (148), Expect = 2e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 113 STAVRSAVEKERTKMRERQRRSITTNIFHGLRKHGGY 3 S++ RS EKE+TK+RERQRR+ITT IFHGLR+HGGY Sbjct: 4 SSSTRSESEKEKTKLRERQRRAITTKIFHGLRRHGGY 40 >ref|XP_002523196.1| PREDICTED: protein BZR1 homolog 4 [Ricinus communis] gi|223537603|gb|EEF39227.1| BRASSINAZOLE-RESISTANT 1 protein, putative [Ricinus communis] Length = 225 Score = 61.6 bits (148), Expect = 2e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 113 STAVRSAVEKERTKMRERQRRSITTNIFHGLRKHGGY 3 S++ RS EKE+TK+RERQRR+ITT IFHGLR+HGGY Sbjct: 4 SSSTRSESEKEKTKLRERQRRAITTKIFHGLRRHGGY 40 >ref|XP_010241187.1| PREDICTED: protein BZR1 homolog 3-like [Nelumbo nucifera] Length = 257 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 101 RSAVEKERTKMRERQRRSITTNIFHGLRKHGGY 3 RSA EKERTKMRERQRR+ITT IF+GLRKHGGY Sbjct: 45 RSASEKERTKMRERQRRAITTKIFNGLRKHGGY 77 >ref|XP_008373727.1| PREDICTED: protein BZR1 homolog 2-like [Malus domestica] Length = 113 Score = 59.3 bits (142), Expect = 2e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 101 RSAVEKERTKMRERQRRSITTNIFHGLRKHGGY 3 RS EKE+TKM+ERQR++ITT IFHGLRKHGGY Sbjct: 9 RSESEKEKTKMKERQRKAITTKIFHGLRKHGGY 41 >ref|XP_012075632.1| PREDICTED: protein BZR1 homolog 3-like [Jatropha curcas] Length = 256 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 113 STAVRSAVEKERTKMRERQRRSITTNIFHGLRKHGGY 3 S++ RS EKE+TK+RERQRR+ITT IFHGLR+HGGY Sbjct: 42 SSSTRSESEKEKTKLRERQRRAITTKIFHGLRRHGGY 78 >ref|XP_011038890.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Populus euphratica] gi|743944110|ref|XP_011016570.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Populus euphratica] Length = 229 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = -1 Query: 122 NNMSTAVRSAVEKERTKMRERQRRSITTNIFHGLRKHGGY 3 ++ S++ RS +KERTK+RERQRR++TT IFHGLRK+GGY Sbjct: 6 SSTSSSSRSESDKERTKLRERQRRAVTTRIFHGLRKYGGY 45 >ref|XP_002298893.2| hypothetical protein POPTR_0001s38140g [Populus trichocarpa] gi|550349154|gb|EEE83698.2| hypothetical protein POPTR_0001s38140g [Populus trichocarpa] Length = 228 Score = 59.3 bits (142), Expect = 2e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 113 STAVRSAVEKERTKMRERQRRSITTNIFHGLRKHGGY 3 S++ RS +KERTK+RERQRR+ITT IFHGLRK+GGY Sbjct: 10 SSSGRSESDKERTKLRERQRRAITTRIFHGLRKYGGY 46