BLASTX nr result
ID: Rehmannia27_contig00030885
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00030885 (528 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41612.1| hypothetical protein MIMGU_mgv1a000803mg [Erythra... 62 2e-08 ref|XP_012831906.1| PREDICTED: uncharacterized protein LOC105952... 62 2e-08 >gb|EYU41612.1| hypothetical protein MIMGU_mgv1a000803mg [Erythranthe guttata] Length = 981 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +3 Query: 6 KLKSFINSRDAKILVGVAGSAVLALSLWRYSRRAANS 116 KLKSFI S+D+KILVG+AGS VLALSLWRYSRRA S Sbjct: 945 KLKSFITSKDSKILVGIAGSVVLALSLWRYSRRATKS 981 >ref|XP_012831906.1| PREDICTED: uncharacterized protein LOC105952868 [Erythranthe guttata] Length = 1005 Score = 62.4 bits (150), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +3 Query: 6 KLKSFINSRDAKILVGVAGSAVLALSLWRYSRRAANS 116 KLKSFI S+D+KILVG+AGS VLALSLWRYSRRA S Sbjct: 969 KLKSFITSKDSKILVGIAGSVVLALSLWRYSRRATKS 1005