BLASTX nr result
ID: Rehmannia27_contig00030871
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00030871 (869 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011100361.1| PREDICTED: O-acyltransferase WSD1-like [Sesa... 65 2e-08 >ref|XP_011100361.1| PREDICTED: O-acyltransferase WSD1-like [Sesamum indicum] Length = 472 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -2 Query: 868 AMTMEKGFIDPNKFKSCIEYAFEIISKAALQSPPTTKT 755 AMTMEKGFIDPN FKSCIEYAFE ISKAAL SP +K+ Sbjct: 435 AMTMEKGFIDPNTFKSCIEYAFEAISKAALASPTPSKS 472