BLASTX nr result
ID: Rehmannia27_contig00030869
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00030869 (512 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096552.1| PREDICTED: mannosyl-oligosaccharide 1,2-alph... 145 7e-38 ref|XP_012842222.1| PREDICTED: mannosyl-oligosaccharide 1,2-alph... 137 6e-35 ref|XP_011014924.1| PREDICTED: mannosyl-oligosaccharide 1,2-alph... 136 2e-34 ref|XP_006467475.1| PREDICTED: mannosyl-oligosaccharide 1,2-alph... 135 3e-34 ref|XP_010538249.1| PREDICTED: mannosyl-oligosaccharide 1,2-alph... 134 1e-33 ref|XP_002306001.2| glycoside hydrolase family 47 family protein... 133 3e-33 ref|XP_009360883.1| PREDICTED: mannosyl-oligosaccharide 1,2-alph... 131 1e-32 ref|XP_010478375.1| PREDICTED: mannosyl-oligosaccharide 1,2-alph... 130 2e-32 ref|XP_010460779.1| PREDICTED: mannosyl-oligosaccharide 1,2-alph... 130 2e-32 ref|XP_010499520.1| PREDICTED: mannosyl-oligosaccharide 1,2-alph... 130 2e-32 ref|XP_006303170.1| hypothetical protein CARUB_v10008589mg [Caps... 130 2e-32 ref|XP_002893595.1| glycoside hydrolase family 47 protein [Arabi... 130 2e-32 dbj|BAJ91264.1| predicted protein, partial [Hordeum vulgare subs... 128 2e-32 ref|XP_008383481.1| PREDICTED: mannosyl-oligosaccharide 1,2-alph... 130 3e-32 ref|XP_006449686.1| hypothetical protein CICLE_v10014607mg [Citr... 130 4e-32 gb|ACN35250.1| unknown [Zea mays] gi|413949481|gb|AFW82130.1| hy... 124 4e-32 gb|KVH89422.1| Glycoside hydrolase, family 47 [Cynara cardunculu... 130 4e-32 ref|XP_007214534.1| hypothetical protein PRUPE_ppa002795mg [Prun... 130 4e-32 gb|ACR34654.1| unknown [Zea mays] 124 4e-32 ref|XP_009421263.1| PREDICTED: mannosyl-oligosaccharide 1,2-alph... 129 5e-32 >ref|XP_011096552.1| PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 [Sesamum indicum] Length = 631 Score = 145 bits (367), Expect = 7e-38 Identities = 68/75 (90%), Positives = 71/75 (94%) Frame = -2 Query: 511 AFEKYTKVDSGGYTSLDDVTVLPPHRRDKMETFFLGETLKYLYLLFGDRNVFPLNEYVFN 332 AFEKYTKVDSGGYTSLDDVTVLPPHRRDKMETFFLGETLKYLYLLFGDRN PL++YVFN Sbjct: 557 AFEKYTKVDSGGYTSLDDVTVLPPHRRDKMETFFLGETLKYLYLLFGDRNAIPLDKYVFN 616 Query: 331 TEAHPLPIRGTAGRK 287 TEAHPLPI+G AG K Sbjct: 617 TEAHPLPIQGNAGTK 631 >ref|XP_012842222.1| PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 [Erythranthe guttata] gi|604327601|gb|EYU33358.1| hypothetical protein MIMGU_mgv1a002872mg [Erythranthe guttata] Length = 629 Score = 137 bits (346), Expect = 6e-35 Identities = 65/74 (87%), Positives = 69/74 (93%) Frame = -2 Query: 511 AFEKYTKVDSGGYTSLDDVTVLPPHRRDKMETFFLGETLKYLYLLFGDRNVFPLNEYVFN 332 AFEKYTKVD+GGYTSLDDVTVLPP+RRDKMETFFLGETLKYLYLLFGDRNV PL++YVFN Sbjct: 555 AFEKYTKVDTGGYTSLDDVTVLPPNRRDKMETFFLGETLKYLYLLFGDRNVIPLDKYVFN 614 Query: 331 TEAHPLPIRGTAGR 290 TEAHP PIR A R Sbjct: 615 TEAHPFPIRDNAVR 628 >ref|XP_011014924.1| PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 [Populus euphratica] Length = 631 Score = 136 bits (342), Expect = 2e-34 Identities = 62/71 (87%), Positives = 69/71 (97%) Frame = -2 Query: 511 AFEKYTKVDSGGYTSLDDVTVLPPHRRDKMETFFLGETLKYLYLLFGDRNVFPLNEYVFN 332 AFEKYTKVDSGGY+SL+DVTVLPPHRRDKMETFFLGETLKY YLLFGDR+V PL++YVFN Sbjct: 561 AFEKYTKVDSGGYSSLEDVTVLPPHRRDKMETFFLGETLKYFYLLFGDRSVIPLDKYVFN 620 Query: 331 TEAHPLPIRGT 299 TEAHPLPI+G+ Sbjct: 621 TEAHPLPIKGS 631 >ref|XP_006467475.1| PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 [Citrus sinensis] Length = 625 Score = 135 bits (341), Expect = 3e-34 Identities = 62/71 (87%), Positives = 68/71 (95%) Frame = -2 Query: 511 AFEKYTKVDSGGYTSLDDVTVLPPHRRDKMETFFLGETLKYLYLLFGDRNVFPLNEYVFN 332 AFEKYTKVDSGGYTSLDDVT+LPPHRRDKMETFFLGETLKYLYLLFGD +V PL+++VFN Sbjct: 554 AFEKYTKVDSGGYTSLDDVTMLPPHRRDKMETFFLGETLKYLYLLFGDSSVIPLDQFVFN 613 Query: 331 TEAHPLPIRGT 299 +EAHP PIRGT Sbjct: 614 SEAHPFPIRGT 624 >ref|XP_010538249.1| PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 [Tarenaya hassleriana] Length = 625 Score = 134 bits (337), Expect = 1e-33 Identities = 61/71 (85%), Positives = 67/71 (94%) Frame = -2 Query: 511 AFEKYTKVDSGGYTSLDDVTVLPPHRRDKMETFFLGETLKYLYLLFGDRNVFPLNEYVFN 332 AFEKYTKVDSGGYTSLDDVT +PPHRRDKMETFFLGETLKYLYLLFGD +V PL+++VFN Sbjct: 554 AFEKYTKVDSGGYTSLDDVTTVPPHRRDKMETFFLGETLKYLYLLFGDSSVIPLDKFVFN 613 Query: 331 TEAHPLPIRGT 299 TEAHPLP+R T Sbjct: 614 TEAHPLPVRNT 624 >ref|XP_002306001.2| glycoside hydrolase family 47 family protein [Populus trichocarpa] gi|550340952|gb|EEE86512.2| glycoside hydrolase family 47 family protein [Populus trichocarpa] Length = 631 Score = 133 bits (334), Expect = 3e-33 Identities = 61/71 (85%), Positives = 68/71 (95%) Frame = -2 Query: 511 AFEKYTKVDSGGYTSLDDVTVLPPHRRDKMETFFLGETLKYLYLLFGDRNVFPLNEYVFN 332 AFEKYTKVDSGGY+SL+DVTVLPP RRDKMETFFLGETLKY YLLFGDR+V PL++YVFN Sbjct: 561 AFEKYTKVDSGGYSSLEDVTVLPPRRRDKMETFFLGETLKYFYLLFGDRSVIPLDKYVFN 620 Query: 331 TEAHPLPIRGT 299 TEAHPLPI+G+ Sbjct: 621 TEAHPLPIKGS 631 >ref|XP_009360883.1| PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 [Pyrus x bretschneideri] Length = 630 Score = 131 bits (329), Expect = 1e-32 Identities = 59/74 (79%), Positives = 69/74 (93%) Frame = -2 Query: 511 AFEKYTKVDSGGYTSLDDVTVLPPHRRDKMETFFLGETLKYLYLLFGDRNVFPLNEYVFN 332 AFEKYT+VD+GGY+SLDDVT +PPH+RDKMETFFLGETLKYLYLLFGD +V PL+++VFN Sbjct: 556 AFEKYTRVDTGGYSSLDDVTSVPPHKRDKMETFFLGETLKYLYLLFGDSSVIPLDKFVFN 615 Query: 331 TEAHPLPIRGTAGR 290 TEAHP+PI GTA R Sbjct: 616 TEAHPIPIEGTAKR 629 >ref|XP_010478375.1| PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 [Camelina sativa] Length = 623 Score = 130 bits (328), Expect = 2e-32 Identities = 61/71 (85%), Positives = 66/71 (92%) Frame = -2 Query: 511 AFEKYTKVDSGGYTSLDDVTVLPPHRRDKMETFFLGETLKYLYLLFGDRNVFPLNEYVFN 332 AFEKYTKV SGGYTSLDDVT +PPHRRDKMETFFLGETLKYLYLLFGD +V PL+++VFN Sbjct: 553 AFEKYTKVKSGGYTSLDDVTEVPPHRRDKMETFFLGETLKYLYLLFGDDSVIPLDKFVFN 612 Query: 331 TEAHPLPIRGT 299 TEAHPLPIR T Sbjct: 613 TEAHPLPIRNT 623 >ref|XP_010460779.1| PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3-like [Camelina sativa] Length = 623 Score = 130 bits (328), Expect = 2e-32 Identities = 61/71 (85%), Positives = 66/71 (92%) Frame = -2 Query: 511 AFEKYTKVDSGGYTSLDDVTVLPPHRRDKMETFFLGETLKYLYLLFGDRNVFPLNEYVFN 332 AFEKYTKV SGGYTSLDDVT +PPHRRDKMETFFLGETLKYLYLLFGD +V PL+++VFN Sbjct: 553 AFEKYTKVKSGGYTSLDDVTEVPPHRRDKMETFFLGETLKYLYLLFGDDSVIPLDKFVFN 612 Query: 331 TEAHPLPIRGT 299 TEAHPLPIR T Sbjct: 613 TEAHPLPIRNT 623 >ref|XP_010499520.1| PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3-like [Camelina sativa] Length = 623 Score = 130 bits (328), Expect = 2e-32 Identities = 61/71 (85%), Positives = 66/71 (92%) Frame = -2 Query: 511 AFEKYTKVDSGGYTSLDDVTVLPPHRRDKMETFFLGETLKYLYLLFGDRNVFPLNEYVFN 332 AFEKYTKV SGGYTSLDDVT +PPHRRDKMETFFLGETLKYLYLLFGD +V PL+++VFN Sbjct: 553 AFEKYTKVKSGGYTSLDDVTEVPPHRRDKMETFFLGETLKYLYLLFGDDSVIPLDKFVFN 612 Query: 331 TEAHPLPIRGT 299 TEAHPLPIR T Sbjct: 613 TEAHPLPIRNT 623 >ref|XP_006303170.1| hypothetical protein CARUB_v10008589mg [Capsella rubella] gi|482571881|gb|EOA36068.1| hypothetical protein CARUB_v10008589mg [Capsella rubella] Length = 623 Score = 130 bits (328), Expect = 2e-32 Identities = 61/71 (85%), Positives = 66/71 (92%) Frame = -2 Query: 511 AFEKYTKVDSGGYTSLDDVTVLPPHRRDKMETFFLGETLKYLYLLFGDRNVFPLNEYVFN 332 AFEKYTKV SGGYTSLDDVT +PPHRRDKMETFFLGETLKYLYLLFGD +V PL+++VFN Sbjct: 553 AFEKYTKVKSGGYTSLDDVTEVPPHRRDKMETFFLGETLKYLYLLFGDDSVIPLDKFVFN 612 Query: 331 TEAHPLPIRGT 299 TEAHPLPIR T Sbjct: 613 TEAHPLPIRNT 623 >ref|XP_002893595.1| glycoside hydrolase family 47 protein [Arabidopsis lyrata subsp. lyrata] gi|297339437|gb|EFH69854.1| glycoside hydrolase family 47 protein [Arabidopsis lyrata subsp. lyrata] Length = 623 Score = 130 bits (328), Expect = 2e-32 Identities = 61/71 (85%), Positives = 66/71 (92%) Frame = -2 Query: 511 AFEKYTKVDSGGYTSLDDVTVLPPHRRDKMETFFLGETLKYLYLLFGDRNVFPLNEYVFN 332 AFEKYTKV SGGYTSLDDVT +PPHRRDKMETFFLGETLKYLYLLFGD +V PL+++VFN Sbjct: 553 AFEKYTKVKSGGYTSLDDVTEVPPHRRDKMETFFLGETLKYLYLLFGDDSVIPLDKFVFN 612 Query: 331 TEAHPLPIRGT 299 TEAHPLPIR T Sbjct: 613 TEAHPLPIRNT 623 >dbj|BAJ91264.1| predicted protein, partial [Hordeum vulgare subsp. vulgare] Length = 433 Score = 128 bits (322), Expect = 2e-32 Identities = 59/68 (86%), Positives = 64/68 (94%) Frame = -2 Query: 511 AFEKYTKVDSGGYTSLDDVTVLPPHRRDKMETFFLGETLKYLYLLFGDRNVFPLNEYVFN 332 AFEKYTKVDSGGYTSLDDVT LPP RRDKMETFFLGETLKYLYLLFG+ N+ PL++YVFN Sbjct: 355 AFEKYTKVDSGGYTSLDDVTSLPPPRRDKMETFFLGETLKYLYLLFGESNILPLDKYVFN 414 Query: 331 TEAHPLPI 308 TEAHPLP+ Sbjct: 415 TEAHPLPV 422 >ref|XP_008383481.1| PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3-like [Malus domestica] Length = 630 Score = 130 bits (327), Expect = 3e-32 Identities = 59/74 (79%), Positives = 68/74 (91%) Frame = -2 Query: 511 AFEKYTKVDSGGYTSLDDVTVLPPHRRDKMETFFLGETLKYLYLLFGDRNVFPLNEYVFN 332 AFEKYT+VD GGY+SLDDVT +PPH+RDKMETFFLGETLKYLYLLFGD +V PL+++VFN Sbjct: 556 AFEKYTRVDXGGYSSLDDVTSVPPHKRDKMETFFLGETLKYLYLLFGDSSVIPLDKFVFN 615 Query: 331 TEAHPLPIRGTAGR 290 TEAHP+PI GTA R Sbjct: 616 TEAHPIPIEGTAKR 629 >ref|XP_006449686.1| hypothetical protein CICLE_v10014607mg [Citrus clementina] gi|557552297|gb|ESR62926.1| hypothetical protein CICLE_v10014607mg [Citrus clementina] Length = 625 Score = 130 bits (326), Expect = 4e-32 Identities = 60/71 (84%), Positives = 66/71 (92%) Frame = -2 Query: 511 AFEKYTKVDSGGYTSLDDVTVLPPHRRDKMETFFLGETLKYLYLLFGDRNVFPLNEYVFN 332 AFEKYTKVDSGGYTSLDDVT+LPP RRDKMETFFLGETLKYLYLLF D +V PL+++VFN Sbjct: 554 AFEKYTKVDSGGYTSLDDVTMLPPRRRDKMETFFLGETLKYLYLLFDDSSVIPLDQFVFN 613 Query: 331 TEAHPLPIRGT 299 +EAHP PIRGT Sbjct: 614 SEAHPFPIRGT 624 >gb|ACN35250.1| unknown [Zea mays] gi|413949481|gb|AFW82130.1| hypothetical protein ZEAMMB73_950164 [Zea mays] Length = 245 Score = 124 bits (310), Expect = 4e-32 Identities = 58/72 (80%), Positives = 63/72 (87%) Frame = -2 Query: 511 AFEKYTKVDSGGYTSLDDVTVLPPHRRDKMETFFLGETLKYLYLLFGDRNVFPLNEYVFN 332 AFEKYTKVDSGGYTSLDDVT LPP RDKMETFFLGETLKYLYLLF + N PL++YVFN Sbjct: 167 AFEKYTKVDSGGYTSLDDVTSLPPSTRDKMETFFLGETLKYLYLLFDENNTLPLDKYVFN 226 Query: 331 TEAHPLPIRGTA 296 TEAHPLP+ +A Sbjct: 227 TEAHPLPVMRSA 238 >gb|KVH89422.1| Glycoside hydrolase, family 47 [Cynara cardunculus var. scolymus] Length = 633 Score = 130 bits (326), Expect = 4e-32 Identities = 61/71 (85%), Positives = 65/71 (91%) Frame = -2 Query: 511 AFEKYTKVDSGGYTSLDDVTVLPPHRRDKMETFFLGETLKYLYLLFGDRNVFPLNEYVFN 332 AFEKYTKVDSGGY+SLDDVTVLPP RRDKMETFFLGETLKYL+LLFGD NV PL E+VFN Sbjct: 559 AFEKYTKVDSGGYSSLDDVTVLPPRRRDKMETFFLGETLKYLFLLFGDGNVIPLTEFVFN 618 Query: 331 TEAHPLPIRGT 299 TEAHP+PI T Sbjct: 619 TEAHPIPIMTT 629 >ref|XP_007214534.1| hypothetical protein PRUPE_ppa002795mg [Prunus persica] gi|462410399|gb|EMJ15733.1| hypothetical protein PRUPE_ppa002795mg [Prunus persica] Length = 633 Score = 130 bits (326), Expect = 4e-32 Identities = 56/74 (75%), Positives = 68/74 (91%) Frame = -2 Query: 511 AFEKYTKVDSGGYTSLDDVTVLPPHRRDKMETFFLGETLKYLYLLFGDRNVFPLNEYVFN 332 AFEKYT++D+GGY+SLDDVT +PPH+RDKMETFFLGETLKYLYLLFGD +V PL+++VFN Sbjct: 559 AFEKYTRIDTGGYSSLDDVTAIPPHKRDKMETFFLGETLKYLYLLFGDSSVLPLDKFVFN 618 Query: 331 TEAHPLPIRGTAGR 290 TEAHP+P+ GT R Sbjct: 619 TEAHPIPVEGTTKR 632 >gb|ACR34654.1| unknown [Zea mays] Length = 248 Score = 124 bits (310), Expect = 4e-32 Identities = 58/72 (80%), Positives = 63/72 (87%) Frame = -2 Query: 511 AFEKYTKVDSGGYTSLDDVTVLPPHRRDKMETFFLGETLKYLYLLFGDRNVFPLNEYVFN 332 AFEKYTKVDSGGYTSLDDVT LPP RDKMETFFLGETLKYLYLLF + N PL++YVFN Sbjct: 170 AFEKYTKVDSGGYTSLDDVTSLPPSTRDKMETFFLGETLKYLYLLFDENNTLPLDKYVFN 229 Query: 331 TEAHPLPIRGTA 296 TEAHPLP+ +A Sbjct: 230 TEAHPLPVMRSA 241 >ref|XP_009421263.1| PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3-like [Musa acuminata subsp. malaccensis] Length = 625 Score = 129 bits (325), Expect = 5e-32 Identities = 60/68 (88%), Positives = 65/68 (95%) Frame = -2 Query: 511 AFEKYTKVDSGGYTSLDDVTVLPPHRRDKMETFFLGETLKYLYLLFGDRNVFPLNEYVFN 332 AFEKYTKVDSGGYTSLDDVT++PP RRDKMETFFLGETLKYLYLLFGD NV PL+++VFN Sbjct: 551 AFEKYTKVDSGGYTSLDDVTLIPPPRRDKMETFFLGETLKYLYLLFGDENVVPLDKFVFN 610 Query: 331 TEAHPLPI 308 TEAHPLPI Sbjct: 611 TEAHPLPI 618