BLASTX nr result
ID: Rehmannia27_contig00029900
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00029900 (469 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011082111.1| PREDICTED: protein CUP-SHAPED COTYLEDON 3 [S... 73 2e-12 ref|XP_006382188.1| hypothetical protein POPTR_0006s29180g [Popu... 58 3e-07 gb|EEF34392.1| transcription factor, putative [Ricinus communis] 58 3e-07 ref|XP_015580124.1| PREDICTED: NAC domain-containing protein 92 ... 58 4e-07 gb|KRH16202.1| hypothetical protein GLYMA_14G140100 [Glycine max] 57 6e-07 gb|KHN15359.1| NAC domain-containing protein 100 [Glycine soja] ... 57 6e-07 gb|KRH16200.1| hypothetical protein GLYMA_14G140100 [Glycine max] 57 6e-07 ref|XP_006596169.2| PREDICTED: NAC domain-containing protein 59-... 57 6e-07 ref|XP_011008664.1| PREDICTED: NAC domain-containing protein 100... 57 8e-07 ref|XP_011008663.1| PREDICTED: NAC domain-containing protein 100... 57 8e-07 ref|XP_011008662.1| PREDICTED: NAC domain-containing protein 100... 57 8e-07 ref|XP_011045044.1| PREDICTED: NAC domain-containing protein 100... 57 1e-06 ref|XP_006371816.1| hypothetical protein POPTR_0018s03910g [Popu... 57 1e-06 ref|XP_011045043.1| PREDICTED: NAC domain-containing protein 100... 57 1e-06 ref|XP_011045042.1| PREDICTED: NAC domain-containing protein 100... 57 1e-06 ref|XP_011045041.1| PREDICTED: NAC domain-containing protein 100... 57 1e-06 gb|KYP70165.1| Protein CUP-SHAPED COTYLEDON 2 [Cajanus cajan] 56 2e-06 ref|XP_006357022.2| PREDICTED: NAC domain-containing protein 100... 55 4e-06 dbj|BAT82214.1| hypothetical protein VIGAN_03219000 [Vigna angul... 55 5e-06 ref|XP_007161321.1| hypothetical protein PHAVU_001G059900g [Phas... 55 5e-06 >ref|XP_011082111.1| PREDICTED: protein CUP-SHAPED COTYLEDON 3 [Sesamum indicum] Length = 339 Score = 72.8 bits (177), Expect = 2e-12 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -3 Query: 431 DMMQGAGYGGDMNSGNTMSNRFMGMDQCADLDNYWPSY 318 D AGYGGDMN+ NTMSNRF+GM+QCADLDNYWPSY Sbjct: 302 DHQAAAGYGGDMNNANTMSNRFIGMEQCADLDNYWPSY 339 >ref|XP_006382188.1| hypothetical protein POPTR_0006s29180g [Populus trichocarpa] gi|550337343|gb|ERP59985.1| hypothetical protein POPTR_0006s29180g [Populus trichocarpa] Length = 316 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = -3 Query: 443 MNHQDMMQGAGYGGDMNSGNTMSNRFMGMDQCADLDNYWPSY 318 MN QD A YG +MN+ N +NRFMGM+QC DL+NYWP Y Sbjct: 278 MNQQD---AAAYGAEMNTANGHANRFMGMEQCMDLENYWPPY 316 >gb|EEF34392.1| transcription factor, putative [Ricinus communis] Length = 379 Score = 58.2 bits (139), Expect = 3e-07 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = -3 Query: 422 QGAGYGGDMNSGNTMSNRFMGMDQCADLDNYWPSY 318 + AGYG +MN+ N S+RFMG++ C DLDNYWPSY Sbjct: 345 EAAGYGAEMNNANAPSSRFMGVEHCMDLDNYWPSY 379 >ref|XP_015580124.1| PREDICTED: NAC domain-containing protein 92 [Ricinus communis] Length = 393 Score = 58.2 bits (139), Expect = 4e-07 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = -3 Query: 422 QGAGYGGDMNSGNTMSNRFMGMDQCADLDNYWPSY 318 + AGYG +MN+ N S+RFMG++ C DLDNYWPSY Sbjct: 359 EAAGYGAEMNNANAPSSRFMGVEHCMDLDNYWPSY 393 >gb|KRH16202.1| hypothetical protein GLYMA_14G140100 [Glycine max] Length = 356 Score = 57.4 bits (137), Expect = 6e-07 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = -3 Query: 413 GYGGDMNSGNTMSNRFMGMDQCADLDNYWPSY 318 GYGG++ S N+ NR+MGMD C DLDNYWPSY Sbjct: 325 GYGGEVASANSHGNRYMGMDHCMDLDNYWPSY 356 >gb|KHN15359.1| NAC domain-containing protein 100 [Glycine soja] gi|947067060|gb|KRH16203.1| hypothetical protein GLYMA_14G140100 [Glycine max] Length = 357 Score = 57.4 bits (137), Expect = 6e-07 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = -3 Query: 413 GYGGDMNSGNTMSNRFMGMDQCADLDNYWPSY 318 GYGG++ S N+ NR+MGMD C DLDNYWPSY Sbjct: 326 GYGGEVASANSHGNRYMGMDHCMDLDNYWPSY 357 >gb|KRH16200.1| hypothetical protein GLYMA_14G140100 [Glycine max] Length = 372 Score = 57.4 bits (137), Expect = 6e-07 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = -3 Query: 413 GYGGDMNSGNTMSNRFMGMDQCADLDNYWPSY 318 GYGG++ S N+ NR+MGMD C DLDNYWPSY Sbjct: 341 GYGGEVASANSHGNRYMGMDHCMDLDNYWPSY 372 >ref|XP_006596169.2| PREDICTED: NAC domain-containing protein 59-like [Glycine max] gi|947067058|gb|KRH16201.1| hypothetical protein GLYMA_14G140100 [Glycine max] Length = 373 Score = 57.4 bits (137), Expect = 6e-07 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = -3 Query: 413 GYGGDMNSGNTMSNRFMGMDQCADLDNYWPSY 318 GYGG++ S N+ NR+MGMD C DLDNYWPSY Sbjct: 342 GYGGEVASANSHGNRYMGMDHCMDLDNYWPSY 373 >ref|XP_011008664.1| PREDICTED: NAC domain-containing protein 100-like isoform X3 [Populus euphratica] gi|743928898|ref|XP_011008665.1| PREDICTED: NAC domain-containing protein 100-like isoform X3 [Populus euphratica] Length = 333 Score = 57.0 bits (136), Expect = 8e-07 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = -3 Query: 422 QGAGYGGDMNSGNTMSNRFMGMDQCADLDNYWPSY 318 Q A YG +MN+ N +NRFMGM+QC DL+NYWP Y Sbjct: 299 QAAAYGAEMNTANGHANRFMGMEQCMDLENYWPPY 333 >ref|XP_011008663.1| PREDICTED: NAC domain-containing protein 100-like isoform X2 [Populus euphratica] Length = 350 Score = 57.0 bits (136), Expect = 8e-07 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = -3 Query: 422 QGAGYGGDMNSGNTMSNRFMGMDQCADLDNYWPSY 318 Q A YG +MN+ N +NRFMGM+QC DL+NYWP Y Sbjct: 316 QAAAYGAEMNTANGHANRFMGMEQCMDLENYWPPY 350 >ref|XP_011008662.1| PREDICTED: NAC domain-containing protein 100-like isoform X1 [Populus euphratica] Length = 351 Score = 57.0 bits (136), Expect = 8e-07 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = -3 Query: 422 QGAGYGGDMNSGNTMSNRFMGMDQCADLDNYWPSY 318 Q A YG +MN+ N +NRFMGM+QC DL+NYWP Y Sbjct: 317 QAAAYGAEMNTANGHANRFMGMEQCMDLENYWPPY 351 >ref|XP_011045044.1| PREDICTED: NAC domain-containing protein 100-like isoform X4 [Populus euphratica] gi|743903394|ref|XP_011045045.1| PREDICTED: NAC domain-containing protein 100-like isoform X4 [Populus euphratica] Length = 330 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = -3 Query: 425 MQGAGYGGDMNSGNTMSNRFMGMDQCADLDNYWPSY 318 ++ A YG +MN+ N SNRFMGM QC DL+NYWP+Y Sbjct: 295 VEQAAYGAEMNNANGPSNRFMGMQQCMDLENYWPAY 330 >ref|XP_006371816.1| hypothetical protein POPTR_0018s03910g [Populus trichocarpa] gi|550317989|gb|ERP49613.1| hypothetical protein POPTR_0018s03910g [Populus trichocarpa] Length = 334 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = -3 Query: 425 MQGAGYGGDMNSGNTMSNRFMGMDQCADLDNYWPSY 318 ++ A YG +MN+ N SNRFMGM QC DL+NYWP+Y Sbjct: 299 VEQAAYGAEMNNANGPSNRFMGMQQCMDLENYWPAY 334 >ref|XP_011045043.1| PREDICTED: NAC domain-containing protein 100-like isoform X3 [Populus euphratica] Length = 347 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = -3 Query: 425 MQGAGYGGDMNSGNTMSNRFMGMDQCADLDNYWPSY 318 ++ A YG +MN+ N SNRFMGM QC DL+NYWP+Y Sbjct: 312 VEQAAYGAEMNNANGPSNRFMGMQQCMDLENYWPAY 347 >ref|XP_011045042.1| PREDICTED: NAC domain-containing protein 100-like isoform X2 [Populus euphratica] Length = 347 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = -3 Query: 425 MQGAGYGGDMNSGNTMSNRFMGMDQCADLDNYWPSY 318 ++ A YG +MN+ N SNRFMGM QC DL+NYWP+Y Sbjct: 312 VEQAAYGAEMNNANGPSNRFMGMQQCMDLENYWPAY 347 >ref|XP_011045041.1| PREDICTED: NAC domain-containing protein 100-like isoform X1 [Populus euphratica] Length = 348 Score = 56.6 bits (135), Expect = 1e-06 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = -3 Query: 425 MQGAGYGGDMNSGNTMSNRFMGMDQCADLDNYWPSY 318 ++ A YG +MN+ N SNRFMGM QC DL+NYWP+Y Sbjct: 313 VEQAAYGAEMNNANGPSNRFMGMQQCMDLENYWPAY 348 >gb|KYP70165.1| Protein CUP-SHAPED COTYLEDON 2 [Cajanus cajan] Length = 343 Score = 56.2 bits (134), Expect = 2e-06 Identities = 22/33 (66%), Positives = 27/33 (81%) Frame = -3 Query: 416 AGYGGDMNSGNTMSNRFMGMDQCADLDNYWPSY 318 AGYG +M++ N+ NRFMGM+ C DLDNYWPSY Sbjct: 311 AGYGSEMSNINSHGNRFMGMEHCMDLDNYWPSY 343 >ref|XP_006357022.2| PREDICTED: NAC domain-containing protein 100-like [Solanum tuberosum] Length = 360 Score = 55.1 bits (131), Expect = 4e-06 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = -3 Query: 410 YGGDMNSGNTMSNRFMGMDQCADLDNYWPSY 318 YGG+MN+ NTM+N M MD CADLDNYW SY Sbjct: 330 YGGEMNNANTMNNSVMTMDNCADLDNYWTSY 360 >dbj|BAT82214.1| hypothetical protein VIGAN_03219000 [Vigna angularis var. angularis] Length = 317 Score = 54.7 bits (130), Expect = 5e-06 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -3 Query: 410 YGGDMNSGNTMSNRFMGMDQCADLDNYWPSY 318 YG DM + N+ NRFMGMD C DLD+YWPSY Sbjct: 287 YGADMTNANSHGNRFMGMDHCMDLDSYWPSY 317 >ref|XP_007161321.1| hypothetical protein PHAVU_001G059900g [Phaseolus vulgaris] gi|561034785|gb|ESW33315.1| hypothetical protein PHAVU_001G059900g [Phaseolus vulgaris] Length = 340 Score = 54.7 bits (130), Expect = 5e-06 Identities = 21/32 (65%), Positives = 24/32 (75%) Frame = -3 Query: 413 GYGGDMNSGNTMSNRFMGMDQCADLDNYWPSY 318 GYG DM + N+ NR+M MD C DLDNYWPSY Sbjct: 309 GYGADMANANSHGNRYMAMDHCMDLDNYWPSY 340