BLASTX nr result
ID: Rehmannia27_contig00029873
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00029873 (545 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012844322.1| PREDICTED: probable sugar phosphate/phosphat... 64 1e-08 ref|XP_011082963.1| PREDICTED: probable sugar phosphate/phosphat... 63 1e-08 >ref|XP_012844322.1| PREDICTED: probable sugar phosphate/phosphate translocator At1g06470 [Erythranthe guttata] gi|848888228|ref|XP_012844323.1| PREDICTED: probable sugar phosphate/phosphate translocator At1g06470 [Erythranthe guttata] gi|848888231|ref|XP_012844324.1| PREDICTED: probable sugar phosphate/phosphate translocator At1g06470 [Erythranthe guttata] gi|604320855|gb|EYU31629.1| hypothetical protein MIMGU_mgv1a005699mg [Erythranthe guttata] Length = 474 Score = 63.5 bits (153), Expect = 1e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +2 Query: 2 KYQKLQKGETTAGSPIDGATSKYVILDEMDEEEDGP 109 KY+KLQKGETT GSP A SKYVILDEMDEE+DGP Sbjct: 439 KYEKLQKGETTVGSPTHDAASKYVILDEMDEEDDGP 474 >ref|XP_011082963.1| PREDICTED: probable sugar phosphate/phosphate translocator At1g06470 [Sesamum indicum] gi|747072128|ref|XP_011082964.1| PREDICTED: probable sugar phosphate/phosphate translocator At1g06470 [Sesamum indicum] Length = 500 Score = 63.2 bits (152), Expect = 1e-08 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = +2 Query: 2 KYQKLQKGETTAGSPIDGATSKYVILDEMDEEEDGP 109 KYQKL GETTAGSP DG SKYVILDEMDEEE+ P Sbjct: 457 KYQKLHNGETTAGSPTDGTASKYVILDEMDEEEEDP 492