BLASTX nr result
ID: Rehmannia27_contig00029741
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00029741 (911 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD59438.1| Rps16 protein [Clivia gardenii] 55 2e-06 ref|YP_009175987.1| ribosomal protein S16 (chloroplast) [Ficus r... 55 4e-06 >emb|CAD59438.1| Rps16 protein [Clivia gardenii] Length = 74 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = +3 Query: 159 IVHDGARVERINSFLGGKDLGLMPINQLEQLRKYIFHI 272 IVHDGAR + I+SF+GGK+LGL+ IN+L+QL KYI +I Sbjct: 25 IVHDGARTKSIDSFIGGKNLGLVTINKLDQLCKYILNI 62 >ref|YP_009175987.1| ribosomal protein S16 (chloroplast) [Ficus racemosa] gi|937500929|gb|ALI30688.1| ribosomal protein S16 (chloroplast) [Ficus racemosa] Length = 117 Score = 54.7 bits (130), Expect = 4e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +3 Query: 159 IVHDGARVERINSFLGGKDLGLMPINQLEQLRKYIFHI 272 I+HDGAR ERI+SF GGK+LGL+ IN+L QL K IF I Sbjct: 4 IIHDGARAERIDSFFGGKNLGLVSINKLRQLCKSIFDI 41