BLASTX nr result
ID: Rehmannia27_contig00029451
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00029451 (458 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO64128.1| hypothetical protein CISIN_1g045842mg [Citrus sin... 65 2e-09 ref|XP_010098020.1| hypothetical protein L484_004222 [Morus nota... 52 1e-06 gb|KOM39063.1| hypothetical protein LR48_Vigan03g244500 [Vigna a... 54 2e-06 >gb|KDO64128.1| hypothetical protein CISIN_1g045842mg [Citrus sinensis] Length = 765 Score = 64.7 bits (156), Expect = 2e-09 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 2/62 (3%) Frame = -2 Query: 358 LIFMNSRISAVSTVSCRPGNKNLF--WILCCFFPRFLGSPVAFVNFLLFKAIVRCPSSSV 185 +IFMN + S VSC GNKN F WIL C P+FLG+P+A+V F L K + R PSS+ Sbjct: 698 VIFMNLKDIGASAVSCYSGNKNHFFSWILFCLLPKFLGTPIAYVPFFLIKVVDRSPSSAF 757 Query: 184 LI 179 ++ Sbjct: 758 VL 759 >ref|XP_010098020.1| hypothetical protein L484_004222 [Morus notabilis] gi|587885532|gb|EXB74403.1| hypothetical protein L484_004222 [Morus notabilis] Length = 67 Score = 52.4 bits (124), Expect = 1e-06 Identities = 28/53 (52%), Positives = 36/53 (67%), Gaps = 3/53 (5%) Frame = +3 Query: 210 IALKSRKFTNATGLPRNRGKKQHKIQKR---FLFPGRQETVDTADILEFMKIR 359 +AL +RK T A G+P+N G KQ+KIQK+ LFP QET D + EFMKI+ Sbjct: 1 MALINRKLTYAKGVPKNFGNKQNKIQKKQRSLLFPELQETTDVSVAFEFMKIK 53 >gb|KOM39063.1| hypothetical protein LR48_Vigan03g244500 [Vigna angularis] Length = 141 Score = 53.9 bits (128), Expect = 2e-06 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 3/56 (5%) Frame = -2 Query: 349 MNSRISAVSTVSCRPGNKN---LFWILCCFFPRFLGSPVAFVNFLLFKAIVRCPSS 191 M+S + VSC GNKN L W+L P+FLG+P A++NFLL +AI R PS+ Sbjct: 1 MSSATTGAYFVSCVSGNKNNDLLCWVLLFLLPKFLGTPFAYINFLLIQAIDRSPSA 56