BLASTX nr result
ID: Rehmannia27_contig00029236
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00029236 (410 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012843952.1| PREDICTED: probable receptor-like protein ki... 57 6e-07 >ref|XP_012843952.1| PREDICTED: probable receptor-like protein kinase At5g24010 [Erythranthe guttata] gi|604321582|gb|EYU32158.1| hypothetical protein MIMGU_mgv1a005643mg [Erythranthe guttata] Length = 476 Score = 57.0 bits (136), Expect = 6e-07 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = -1 Query: 410 HTGXXXXXXXXXXXXLSASMFLRRRRNSSV-AWSRLPLDVSEANLKYGNQFSSIK 249 HTG +S S+F +RRR+S V AWSRLP+DVSEANLK GNQ SS+K Sbjct: 421 HTGVLVPLVAVIFLLVSLSVFFQRRRSSGVVAWSRLPVDVSEANLKCGNQMSSMK 475