BLASTX nr result
ID: Rehmannia27_contig00028199
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00028199 (449 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46710.1| hypothetical protein MIMGU_mgv1a024591mg, partial... 65 8e-10 ref|XP_012836268.1| PREDICTED: aspartic proteinase nepenthesin-1... 65 8e-10 >gb|EYU46710.1| hypothetical protein MIMGU_mgv1a024591mg, partial [Erythranthe guttata] Length = 374 Score = 65.5 bits (158), Expect = 8e-10 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 1 IDGMTIVGAFQQANTRFIFDTVKQKLYFGPEDCTLGA 111 IDG+ ++GA QQANTRF+FD VK+KLYFG EDCTLGA Sbjct: 338 IDGLIVIGALQQANTRFVFDIVKRKLYFGHEDCTLGA 374 >ref|XP_012836268.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Erythranthe guttata] Length = 378 Score = 65.5 bits (158), Expect = 8e-10 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 1 IDGMTIVGAFQQANTRFIFDTVKQKLYFGPEDCTLGA 111 IDG+ ++GA QQANTRF+FD VK+KLYFG EDCTLGA Sbjct: 342 IDGLIVIGALQQANTRFVFDIVKRKLYFGHEDCTLGA 378