BLASTX nr result
ID: Rehmannia27_contig00028171
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00028171 (571 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32493.1| hypothetical protein MIMGU_mgv1a0001071mg, partia... 83 1e-16 >gb|EYU32493.1| hypothetical protein MIMGU_mgv1a0001071mg, partial [Erythranthe guttata] Length = 207 Score = 83.2 bits (204), Expect = 1e-16 Identities = 46/91 (50%), Positives = 56/91 (61%), Gaps = 2/91 (2%) Frame = -3 Query: 518 QRPILDRSHPCEVDLPPKPYFHRNHLXXXXP--SRYKIPSRLIHDYPERNPILEYEIFRP 345 +RP +R + E + KPYF+R+ L P + IP R IHDYPERNPI + EIFR Sbjct: 87 ERPYRERPYHHEFEPLSKPYFNRDLLPPPPPPPGQENIPFRNIHDYPERNPIFKDEIFRR 146 Query: 344 GLSDNYIHELAESRDRNLHCGVREFHTRVPD 252 G DNY+HEL E+ DRNL G RE RV D Sbjct: 147 GCGDNYLHELPENWDRNLQLGERELRIRVHD 177