BLASTX nr result
ID: Rehmannia27_contig00028111
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00028111 (362 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23207.1| hypothetical protein MIMGU_mgv1a004151mg [Erythra... 58 2e-07 ref|XP_012854445.1| PREDICTED: rab proteins geranylgeranyltransf... 58 2e-07 ref|XP_011097095.1| PREDICTED: rab proteins geranylgeranyltransf... 55 2e-06 >gb|EYU23207.1| hypothetical protein MIMGU_mgv1a004151mg [Erythranthe guttata] Length = 539 Score = 57.8 bits (138), Expect = 2e-07 Identities = 30/50 (60%), Positives = 34/50 (68%) Frame = +1 Query: 211 QDGGAYKGVKLGSGQELFSSQLILAPHLTIPSTLAPAEQVTTCHDVRLSD 360 +D G YKG+KL SGQELFS +LI+AP TIPST QV DV LSD Sbjct: 313 KDSGEYKGIKLVSGQELFSPKLIIAPSFTIPSTPNHDAQVANSDDVSLSD 362 >ref|XP_012854445.1| PREDICTED: rab proteins geranylgeranyltransferase component A [Erythranthe guttata] gi|604303805|gb|EYU23206.1| hypothetical protein MIMGU_mgv1a004151mg [Erythranthe guttata] Length = 541 Score = 57.8 bits (138), Expect = 2e-07 Identities = 30/50 (60%), Positives = 34/50 (68%) Frame = +1 Query: 211 QDGGAYKGVKLGSGQELFSSQLILAPHLTIPSTLAPAEQVTTCHDVRLSD 360 +D G YKG+KL SGQELFS +LI+AP TIPST QV DV LSD Sbjct: 313 KDSGEYKGIKLVSGQELFSPKLIIAPSFTIPSTPNHDAQVANSDDVSLSD 362 >ref|XP_011097095.1| PREDICTED: rab proteins geranylgeranyltransferase component A [Sesamum indicum] Length = 537 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 2/45 (4%) Frame = +1 Query: 211 QDGGAYKGVKLGSGQELFSSQLILAPHLTIPSTL--APAEQVTTC 339 +D G YKGVKL SGQELFS QLI+AP T PSTL +PA+ +C Sbjct: 313 KDDGTYKGVKLVSGQELFSPQLIVAPSFTFPSTLGPSPAQVANSC 357