BLASTX nr result
ID: Rehmannia27_contig00028093
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00028093 (370 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011085316.1| PREDICTED: CTD small phosphatase-like protei... 84 4e-17 ref|XP_002316807.2| hypothetical protein POPTR_0011s06780g [Popu... 74 2e-13 ref|XP_009776554.1| PREDICTED: probable C-terminal domain small ... 72 8e-13 ref|XP_015064255.1| PREDICTED: probable C-terminal domain small ... 70 8e-12 ref|XP_006358085.1| PREDICTED: CTD small phosphatase-like protei... 70 8e-12 ref|XP_011039376.1| PREDICTED: carboxy-terminal domain RNA polym... 69 1e-11 ref|XP_009593846.1| PREDICTED: probable C-terminal domain small ... 69 2e-11 ref|XP_004233068.1| PREDICTED: CTD small phosphatase-like protei... 67 5e-11 ref|XP_011010921.1| PREDICTED: probable C-terminal domain small ... 64 2e-10 emb|CDO96877.1| unnamed protein product [Coffea canephora] 65 3e-10 ref|XP_012830505.1| PREDICTED: CTD small phosphatase-like protei... 65 3e-10 ref|XP_002522273.1| PREDICTED: carboxy-terminal domain RNA polym... 65 5e-10 ref|XP_002264996.1| PREDICTED: carboxy-terminal domain RNA polym... 64 7e-10 ref|XP_010105625.1| CTD small phosphatase-like protein [Morus no... 64 7e-10 ref|XP_002305050.2| hypothetical protein POPTR_0004s06150g [Popu... 64 1e-09 ref|XP_012091846.1| PREDICTED: carboxy-terminal domain RNA polym... 64 1e-09 ref|XP_008383597.1| PREDICTED: carboxy-terminal domain RNA polym... 63 2e-09 gb|KNA17510.1| hypothetical protein SOVF_079280 [Spinacia oleracea] 61 1e-08 ref|XP_008225241.1| PREDICTED: carboxy-terminal domain RNA polym... 60 2e-08 ref|XP_010248403.1| PREDICTED: carboxy-terminal domain RNA polym... 60 3e-08 >ref|XP_011085316.1| PREDICTED: CTD small phosphatase-like protein [Sesamum indicum] Length = 295 Score = 84.0 bits (206), Expect = 4e-17 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -2 Query: 369 PDNAIPIKPFTDDLGDEELKGLMKFFEGCDLVEDMRDAVKVYLAD 235 PDNAIPIKPFTDDLGDEELKGL++FFEGC+ VED RDAVK YL D Sbjct: 242 PDNAIPIKPFTDDLGDEELKGLIQFFEGCEEVEDTRDAVKAYLTD 286 >ref|XP_002316807.2| hypothetical protein POPTR_0011s06780g [Populus trichocarpa] gi|550327828|gb|EEE97419.2| hypothetical protein POPTR_0011s06780g [Populus trichocarpa] Length = 294 Score = 74.3 bits (181), Expect = 2e-13 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = -2 Query: 369 PDNAIPIKPFTDDLGDEELKGLMKFFEGCDLVEDMRDAVKVYLADLK 229 P NAIP+KPFTDDLGD EL+ L+ FFE CD EDMRDAVK Y D+K Sbjct: 238 PKNAIPVKPFTDDLGDSELENLIAFFERCDCFEDMRDAVKEYFGDMK 284 >ref|XP_009776554.1| PREDICTED: probable C-terminal domain small phosphatase [Nicotiana sylvestris] Length = 294 Score = 72.4 bits (176), Expect = 8e-13 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -2 Query: 369 PDNAIPIKPFTDDLGDEELKGLMKFFEGCDLVEDMRDAVKVYLA 238 P+NAIPI+PFTDDLGD ELK L++F GC VEDMRDAVKVYLA Sbjct: 241 PENAIPIRPFTDDLGDGELKKLIEFLNGCVEVEDMRDAVKVYLA 284 >ref|XP_015064255.1| PREDICTED: probable C-terminal domain small phosphatase [Solanum pennellii] Length = 292 Score = 69.7 bits (169), Expect = 8e-12 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -2 Query: 369 PDNAIPIKPFTDDLGDEELKGLMKFFEGCDLVEDMRDAVKVYLADLKG 226 P+NAIPI+PFT+DL D ELK L++F GC+ VEDMR+AVKVYLA+ +G Sbjct: 239 PENAIPIRPFTNDLADGELKKLIEFLGGCNEVEDMREAVKVYLAEEEG 286 >ref|XP_006358085.1| PREDICTED: CTD small phosphatase-like protein [Solanum tuberosum] Length = 292 Score = 69.7 bits (169), Expect = 8e-12 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -2 Query: 369 PDNAIPIKPFTDDLGDEELKGLMKFFEGCDLVEDMRDAVKVYLAD 235 P+NAIPI+PFT+DL D ELK L++F GC+ VEDMRDAVKVYLA+ Sbjct: 239 PENAIPIRPFTNDLADGELKKLIEFLGGCNEVEDMRDAVKVYLAE 283 >ref|XP_011039376.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 [Populus euphratica] Length = 292 Score = 69.3 bits (168), Expect = 1e-11 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -2 Query: 369 PDNAIPIKPFTDDLGDEELKGLMKFFEGCDLVEDMRDAVKVY 244 P NAIP+KPFTDDLGD EL+ L+ FFE CD EDMRDAVK Y Sbjct: 238 PKNAIPVKPFTDDLGDSELENLVAFFERCDCFEDMRDAVKEY 279 >ref|XP_009593846.1| PREDICTED: probable C-terminal domain small phosphatase [Nicotiana tomentosiformis] Length = 295 Score = 68.6 bits (166), Expect = 2e-11 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = -2 Query: 369 PDNAIPIKPFTDDLGDEELKGLMKFFEGCDLVEDMRDAVKVYLAD 235 P+NAIPI+PFTDDL D ELK L +F GC VEDMRD VKVYLA+ Sbjct: 241 PENAIPIRPFTDDLADGELKKLTEFLNGCVEVEDMRDVVKVYLAE 285 >ref|XP_004233068.1| PREDICTED: CTD small phosphatase-like protein [Solanum lycopersicum] Length = 292 Score = 67.4 bits (163), Expect = 5e-11 Identities = 31/48 (64%), Positives = 40/48 (83%) Frame = -2 Query: 369 PDNAIPIKPFTDDLGDEELKGLMKFFEGCDLVEDMRDAVKVYLADLKG 226 P+NAIPI+PF +DL D ELK L++F GC+ VEDMR+AVKVYLA+ +G Sbjct: 239 PENAIPIRPFMNDLADGELKKLIEFLGGCNEVEDMREAVKVYLAEEEG 286 >ref|XP_011010921.1| PREDICTED: probable C-terminal domain small phosphatase, partial [Populus euphratica] Length = 138 Score = 63.5 bits (153), Expect = 2e-10 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -2 Query: 369 PDNAIPIKPFTDDLGDEELKGLMKFFEGCDLVEDMRDAVKVYL 241 P+NAIP+KPF DDLGD EL L FF+ CD EDMRDAVK Y+ Sbjct: 85 PENAIPVKPFLDDLGDLELGKLATFFDRCDCFEDMRDAVKEYV 127 >emb|CDO96877.1| unnamed protein product [Coffea canephora] Length = 293 Score = 65.5 bits (158), Expect = 3e-10 Identities = 31/48 (64%), Positives = 36/48 (75%) Frame = -2 Query: 369 PDNAIPIKPFTDDLGDEELKGLMKFFEGCDLVEDMRDAVKVYLADLKG 226 PDNA+PI PF DDLGD ELK L++FFE D VED RDAVK Y++ G Sbjct: 243 PDNALPILPFIDDLGDGELKNLIQFFEKLDEVEDTRDAVKNYVSQFAG 290 >ref|XP_012830505.1| PREDICTED: CTD small phosphatase-like protein [Erythranthe guttata] gi|604344549|gb|EYU43303.1| hypothetical protein MIMGU_mgv1a011086mg [Erythranthe guttata] Length = 293 Score = 65.5 bits (158), Expect = 3e-10 Identities = 32/49 (65%), Positives = 40/49 (81%), Gaps = 2/49 (4%) Frame = -2 Query: 369 PDNAIPIKPFTDDLGDEELKGLMKFFEG--CDLVEDMRDAVKVYLADLK 229 PDNAIPIK FT+DL D+ELK L++FFE CD VEDMRD+VK++ A+ K Sbjct: 245 PDNAIPIKAFTNDLEDDELKKLVEFFESFDCDSVEDMRDSVKLHFAESK 293 >ref|XP_002522273.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 [Ricinus communis] gi|223538526|gb|EEF40131.1| Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase, putative [Ricinus communis] Length = 300 Score = 64.7 bits (156), Expect = 5e-10 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = -2 Query: 369 PDNAIPIKPFTDDLGDEELKGLMKFFEGCDLVEDMRDAVKVYL 241 PDNAIPIKPF DDL D EL L KFF GCD VEDMR+AVK ++ Sbjct: 245 PDNAIPIKPFIDDLRDGELGKLAKFFNGCDGVEDMRNAVKQFV 287 >ref|XP_002264996.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1-like [Vitis vinifera] Length = 285 Score = 64.3 bits (155), Expect = 7e-10 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -2 Query: 369 PDNAIPIKPFTDDLGDEELKGLMKFFEGCDLVEDMRDAVKVYLA 238 P+NAIP+ PF DDL D EL+ L++FFEGCD +DMRDAVK Y A Sbjct: 233 PENAIPMPPFIDDLADGELENLIEFFEGCDSFKDMRDAVKHYQA 276 >ref|XP_010105625.1| CTD small phosphatase-like protein [Morus notabilis] gi|587966094|gb|EXC51209.1| CTD small phosphatase-like protein [Morus notabilis] Length = 295 Score = 64.3 bits (155), Expect = 7e-10 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -2 Query: 369 PDNAIPIKPFTDDLGDEELKGLMKFFEGCDLVEDMRDAVKVYLA 238 P+NA+P++PF DDLGD EL L+ FFEG D +DMRDAV+ YLA Sbjct: 241 PENAVPVRPFVDDLGDRELGKLVGFFEGSDCFDDMRDAVRHYLA 284 >ref|XP_002305050.2| hypothetical protein POPTR_0004s06150g [Populus trichocarpa] gi|550340433|gb|EEE85561.2| hypothetical protein POPTR_0004s06150g [Populus trichocarpa] Length = 293 Score = 63.5 bits (153), Expect = 1e-09 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -2 Query: 369 PDNAIPIKPFTDDLGDEELKGLMKFFEGCDLVEDMRDAVKVYL 241 P+NAIP+KPF DDLGD EL L FF+ CD EDMRDAVK Y+ Sbjct: 239 PENAIPVKPFLDDLGDLELGKLATFFDRCDCFEDMRDAVKEYV 281 >ref|XP_012091846.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1-like [Jatropha curcas] gi|643704086|gb|KDP21150.1| hypothetical protein JCGZ_21621 [Jatropha curcas] Length = 296 Score = 63.5 bits (153), Expect = 1e-09 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -2 Query: 369 PDNAIPIKPFTDDLGDEELKGLMKFFEGCDLVEDMRDAVKVYL 241 P+NAIP++PF DDLGD EL L+KFFE CD ED+RDAVK ++ Sbjct: 245 PENAIPVRPFIDDLGDGELGKLVKFFEECDSFEDIRDAVKQFV 287 >ref|XP_008383597.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1-like [Malus domestica] Length = 288 Score = 62.8 bits (151), Expect = 2e-09 Identities = 30/53 (56%), Positives = 37/53 (69%) Frame = -2 Query: 369 PDNAIPIKPFTDDLGDEELKGLMKFFEGCDLVEDMRDAVKVYLADLKGEKVGG 211 PDNA+P++PF DD+ D EL L++FFEG D EDMRDAVK +L G GG Sbjct: 230 PDNAVPVRPFVDDMEDRELGRLVEFFEGLD-CEDMRDAVKKFLGSTGGRDGGG 281 >gb|KNA17510.1| hypothetical protein SOVF_079280 [Spinacia oleracea] Length = 293 Score = 60.8 bits (146), Expect = 1e-08 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -2 Query: 369 PDNAIPIKPFTDDLGDEELKGLMKFFEGCDLVEDMRDAVKVY 244 P+NAI IKPFTDDL D EL L +FFE CD V+D+RDAVK++ Sbjct: 240 PENAIQIKPFTDDLQDNELSKLSRFFEVCDGVKDIRDAVKLF 281 >ref|XP_008225241.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1-like [Prunus mume] Length = 284 Score = 60.1 bits (144), Expect = 2e-08 Identities = 29/54 (53%), Positives = 40/54 (74%) Frame = -2 Query: 369 PDNAIPIKPFTDDLGDEELKGLMKFFEGCDLVEDMRDAVKVYLADLKGEKVGGG 208 P+NA+P++PF DD+ D EL LM+FF+G + +DMRDAVK ++A G VGGG Sbjct: 226 PENAVPVRPFVDDMADRELGKLMEFFDGLN-CDDMRDAVKQFVAAASG--VGGG 276 >ref|XP_010248403.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2-like [Nelumbo nucifera] Length = 297 Score = 59.7 bits (143), Expect = 3e-08 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = -2 Query: 369 PDNAIPIKPFTDDLGDEELKGLMKFFEGCDLVEDMRDAVKVYLA 238 P+NA+P++PF DDL D+EL+ ++KFFE D EDMRDAVK +L+ Sbjct: 238 PENALPVRPFIDDLQDQELRRVIKFFEVADGFEDMRDAVKNFLS 281