BLASTX nr result
ID: Rehmannia27_contig00028060
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00028060 (345 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096330.1| PREDICTED: glyoxysomal processing protease, ... 59 8e-08 >ref|XP_011096330.1| PREDICTED: glyoxysomal processing protease, glyoxysomal [Sesamum indicum] Length = 743 Score = 58.5 bits (140), Expect = 8e-08 Identities = 31/42 (73%), Positives = 33/42 (78%), Gaps = 3/42 (7%) Frame = -2 Query: 344 PTEDNSKGMKGSRFAKFIADRNELLKTKVQD---GSFSNGLI 228 P EDNSKG KGSRFAKFIADRNELLK VQ G+F+N LI Sbjct: 698 PAEDNSKGTKGSRFAKFIADRNELLKKTVQHGMAGTFTNELI 739