BLASTX nr result
ID: Rehmannia27_contig00027424
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00027424 (392 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34066.1| hypothetical protein MIMGU_mgv1a002012mg [Erythra... 62 6e-09 ref|XP_012841349.1| PREDICTED: granule-bound starch synthase 2, ... 62 6e-09 >gb|EYU34066.1| hypothetical protein MIMGU_mgv1a002012mg [Erythranthe guttata] Length = 726 Score = 62.4 bits (150), Expect = 6e-09 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -3 Query: 120 MASMGSFPAGVDSSVILHSSNHHSPMVPLLAYRPRK 13 MASMGSFP G+D S++LHS+NH P++P+LAYRPRK Sbjct: 1 MASMGSFPTGLDGSILLHSANHQRPVIPILAYRPRK 36 >ref|XP_012841349.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic [Erythranthe guttata] Length = 754 Score = 62.4 bits (150), Expect = 6e-09 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -3 Query: 120 MASMGSFPAGVDSSVILHSSNHHSPMVPLLAYRPRK 13 MASMGSFP G+D S++LHS+NH P++P+LAYRPRK Sbjct: 1 MASMGSFPTGLDGSILLHSANHQRPVIPILAYRPRK 36