BLASTX nr result
ID: Rehmannia27_contig00027421
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00027421 (656 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073428.1| PREDICTED: putative F-box/LRR-repeat protein... 81 2e-14 >ref|XP_011073428.1| PREDICTED: putative F-box/LRR-repeat protein At5g41840 [Sesamum indicum] gi|747054443|ref|XP_011073429.1| PREDICTED: putative F-box/LRR-repeat protein At5g41840 [Sesamum indicum] gi|747054445|ref|XP_011073430.1| PREDICTED: putative F-box/LRR-repeat protein At5g41840 [Sesamum indicum] Length = 407 Score = 80.9 bits (198), Expect = 2e-14 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +2 Query: 182 AKRLKSLQLARLDLDENFSQYPFESDIQAAELIKVCSDTEKLWLSENV 325 AK LK L++ARLDLDEN SQYP+ESD QAA+LIKVCSD EKLWLSENV Sbjct: 270 AKTLKCLRIARLDLDENVSQYPYESDEQAAKLIKVCSDAEKLWLSENV 317