BLASTX nr result
ID: Rehmannia27_contig00027209
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00027209 (416 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011085408.1| PREDICTED: protein TRIGALACTOSYLDIACYLGLYCER... 57 6e-07 gb|KHN12256.1| hypothetical protein glysoja_035958 [Glycine soja] 56 1e-06 gb|KYP59946.1| hypothetical protein KK1_015393 [Cajanus cajan] 56 1e-06 ref|XP_003529011.1| PREDICTED: protein TRIGALACTOSYLDIACYLGLYCER... 55 2e-06 ref|XP_007052413.1| Chloroplast, plasma membrane, plastid, chlor... 55 2e-06 gb|KRH48903.1| hypothetical protein GLYMA_07G120500 [Glycine max] 55 2e-06 ref|XP_011093486.1| PREDICTED: protein TRIGALACTOSYLDIACYLGLYCER... 55 3e-06 ref|XP_011093485.1| PREDICTED: protein TRIGALACTOSYLDIACYLGLYCER... 55 3e-06 gb|KOM58554.1| hypothetical protein LR48_Vigan11g158800 [Vigna a... 55 3e-06 dbj|BAT96888.1| hypothetical protein VIGAN_09020500 [Vigna angul... 55 3e-06 ref|XP_014514997.1| PREDICTED: protein TRIGALACTOSYLDIACYLGLYCER... 55 3e-06 ref|XP_007134366.1| hypothetical protein PHAVU_010G041600g [Phas... 55 3e-06 ref|XP_011093483.1| PREDICTED: protein TRIGALACTOSYLDIACYLGLYCER... 55 3e-06 ref|XP_009767529.1| PREDICTED: protein TRIGALACTOSYLDIACYLGLYCER... 55 4e-06 ref|XP_009613429.1| PREDICTED: protein TRIGALACTOSYLDIACYLGLYCER... 55 4e-06 ref|XP_012083757.1| PREDICTED: protein TRIGALACTOSYLDIACYLGLYCER... 54 5e-06 ref|XP_006375100.1| hypothetical protein POPTR_0014s04370g [Popu... 54 5e-06 gb|KVG72805.1| Protein of unknown function DUF3769 [Cynara cardu... 54 5e-06 ref|XP_006354638.1| PREDICTED: protein TRIGALACTOSYLDIACYLGLYCER... 54 7e-06 emb|CAN64366.1| hypothetical protein VITISV_031303 [Vitis vinifera] 54 7e-06 >ref|XP_011085408.1| PREDICTED: protein TRIGALACTOSYLDIACYLGLYCEROL 4, chloroplastic-like [Sesamum indicum] Length = 469 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 343 LPDHDITLEATWPELFIDHKGKYW 414 LPDHDITLEA WPELFIDHKGKYW Sbjct: 176 LPDHDITLEAGWPELFIDHKGKYW 199 >gb|KHN12256.1| hypothetical protein glysoja_035958 [Glycine soja] Length = 470 Score = 56.2 bits (134), Expect = 1e-06 Identities = 20/25 (80%), Positives = 24/25 (96%) Frame = +1 Query: 340 ILPDHDITLEATWPELFIDHKGKYW 414 +LPDHD+TLEA WP+LF+DHKGKYW Sbjct: 181 LLPDHDLTLEAAWPQLFVDHKGKYW 205 >gb|KYP59946.1| hypothetical protein KK1_015393 [Cajanus cajan] Length = 461 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/37 (64%), Positives = 27/37 (72%), Gaps = 3/37 (8%) Frame = +1 Query: 313 IVNTTS---HIAILPDHDITLEATWPELFIDHKGKYW 414 + N TS H LPDHD+T EA WP+LFIDHKGKYW Sbjct: 160 VYNETSEKQHSLQLPDHDLTFEAAWPQLFIDHKGKYW 196 >ref|XP_003529011.1| PREDICTED: protein TRIGALACTOSYLDIACYLGLYCEROL 4, chloroplastic-like [Glycine max] gi|947100412|gb|KRH48904.1| hypothetical protein GLYMA_07G120500 [Glycine max] Length = 464 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/24 (83%), Positives = 23/24 (95%) Frame = +1 Query: 343 LPDHDITLEATWPELFIDHKGKYW 414 LPDHD+TLEA WP+LF+DHKGKYW Sbjct: 176 LPDHDLTLEAAWPQLFVDHKGKYW 199 >ref|XP_007052413.1| Chloroplast, plasma membrane, plastid, chloroplast envelope, putative [Theobroma cacao] gi|508704674|gb|EOX96570.1| Chloroplast, plasma membrane, plastid, chloroplast envelope, putative [Theobroma cacao] Length = 469 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = +1 Query: 343 LPDHDITLEATWPELFIDHKGKYW 414 LPDHDITL+A WPELF+DHKGKYW Sbjct: 175 LPDHDITLDAAWPELFMDHKGKYW 198 >gb|KRH48903.1| hypothetical protein GLYMA_07G120500 [Glycine max] Length = 480 Score = 55.5 bits (132), Expect = 2e-06 Identities = 20/24 (83%), Positives = 23/24 (95%) Frame = +1 Query: 343 LPDHDITLEATWPELFIDHKGKYW 414 LPDHD+TLEA WP+LF+DHKGKYW Sbjct: 176 LPDHDLTLEAAWPQLFVDHKGKYW 199 >ref|XP_011093486.1| PREDICTED: protein TRIGALACTOSYLDIACYLGLYCEROL 4, chloroplastic isoform X3 [Sesamum indicum] Length = 386 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = +1 Query: 346 PDHDITLEATWPELFIDHKGKYW 414 PDHDITLEA WP+LFIDHKGKYW Sbjct: 89 PDHDITLEAAWPQLFIDHKGKYW 111 >ref|XP_011093485.1| PREDICTED: protein TRIGALACTOSYLDIACYLGLYCEROL 4, chloroplastic isoform X2 [Sesamum indicum] Length = 394 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = +1 Query: 346 PDHDITLEATWPELFIDHKGKYW 414 PDHDITLEA WP+LFIDHKGKYW Sbjct: 97 PDHDITLEAAWPQLFIDHKGKYW 119 >gb|KOM58554.1| hypothetical protein LR48_Vigan11g158800 [Vigna angularis] Length = 447 Score = 55.1 bits (131), Expect = 3e-06 Identities = 20/24 (83%), Positives = 23/24 (95%) Frame = +1 Query: 343 LPDHDITLEATWPELFIDHKGKYW 414 LPDHD+TLEA WP+LF+DHKGKYW Sbjct: 170 LPDHDLTLEAAWPQLFLDHKGKYW 193 >dbj|BAT96888.1| hypothetical protein VIGAN_09020500 [Vigna angularis var. angularis] Length = 453 Score = 55.1 bits (131), Expect = 3e-06 Identities = 20/24 (83%), Positives = 23/24 (95%) Frame = +1 Query: 343 LPDHDITLEATWPELFIDHKGKYW 414 LPDHD+TLEA WP+LF+DHKGKYW Sbjct: 176 LPDHDLTLEAAWPQLFLDHKGKYW 199 >ref|XP_014514997.1| PREDICTED: protein TRIGALACTOSYLDIACYLGLYCEROL 4, chloroplastic [Vigna radiata var. radiata] Length = 453 Score = 55.1 bits (131), Expect = 3e-06 Identities = 20/24 (83%), Positives = 23/24 (95%) Frame = +1 Query: 343 LPDHDITLEATWPELFIDHKGKYW 414 LPDHD+TLEA WP+LF+DHKGKYW Sbjct: 176 LPDHDLTLEAAWPQLFLDHKGKYW 199 >ref|XP_007134366.1| hypothetical protein PHAVU_010G041600g [Phaseolus vulgaris] gi|561007411|gb|ESW06360.1| hypothetical protein PHAVU_010G041600g [Phaseolus vulgaris] Length = 454 Score = 55.1 bits (131), Expect = 3e-06 Identities = 20/24 (83%), Positives = 23/24 (95%) Frame = +1 Query: 343 LPDHDITLEATWPELFIDHKGKYW 414 LPDHD+TLEA WP+LF+DHKGKYW Sbjct: 176 LPDHDLTLEAAWPQLFLDHKGKYW 199 >ref|XP_011093483.1| PREDICTED: protein TRIGALACTOSYLDIACYLGLYCEROL 4, chloroplastic isoform X1 [Sesamum indicum] Length = 474 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = +1 Query: 346 PDHDITLEATWPELFIDHKGKYW 414 PDHDITLEA WP+LFIDHKGKYW Sbjct: 177 PDHDITLEAAWPQLFIDHKGKYW 199 >ref|XP_009767529.1| PREDICTED: protein TRIGALACTOSYLDIACYLGLYCEROL 4, chloroplastic [Nicotiana sylvestris] Length = 454 Score = 54.7 bits (130), Expect = 4e-06 Identities = 20/24 (83%), Positives = 23/24 (95%) Frame = +1 Query: 343 LPDHDITLEATWPELFIDHKGKYW 414 LP+HD+TLEA WPELFIDHKG+YW Sbjct: 175 LPEHDVTLEAAWPELFIDHKGRYW 198 >ref|XP_009613429.1| PREDICTED: protein TRIGALACTOSYLDIACYLGLYCEROL 4, chloroplastic [Nicotiana tomentosiformis] Length = 461 Score = 54.7 bits (130), Expect = 4e-06 Identities = 20/24 (83%), Positives = 23/24 (95%) Frame = +1 Query: 343 LPDHDITLEATWPELFIDHKGKYW 414 LP+HD+TLEA WPELFIDHKG+YW Sbjct: 175 LPEHDVTLEAAWPELFIDHKGRYW 198 >ref|XP_012083757.1| PREDICTED: protein TRIGALACTOSYLDIACYLGLYCEROL 4, chloroplastic [Jatropha curcas] gi|643717280|gb|KDP28906.1| hypothetical protein JCGZ_14677 [Jatropha curcas] Length = 468 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 343 LPDHDITLEATWPELFIDHKGKYW 414 LP HDITLEA WPELFIDHKG+YW Sbjct: 175 LPSHDITLEAAWPELFIDHKGRYW 198 >ref|XP_006375100.1| hypothetical protein POPTR_0014s04370g [Populus trichocarpa] gi|550323415|gb|ERP52897.1| hypothetical protein POPTR_0014s04370g [Populus trichocarpa] Length = 471 Score = 54.3 bits (129), Expect = 5e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +1 Query: 343 LPDHDITLEATWPELFIDHKGKYW 414 LPDHDITLEA WP LF+DHKGKYW Sbjct: 174 LPDHDITLEAAWPGLFLDHKGKYW 197 >gb|KVG72805.1| Protein of unknown function DUF3769 [Cynara cardunculus var. scolymus] Length = 483 Score = 54.3 bits (129), Expect = 5e-06 Identities = 24/41 (58%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = +1 Query: 295 TSKLQQIVNTTSHIAI-LPDHDITLEATWPELFIDHKGKYW 414 T+ Q + H A+ LPDHDITLEA WPELF+D GKYW Sbjct: 193 TTSSQDSCHDVIHFAVQLPDHDITLEAAWPELFVDRYGKYW 233 >ref|XP_006354638.1| PREDICTED: protein TRIGALACTOSYLDIACYLGLYCEROL 4, chloroplastic [Solanum tuberosum] Length = 458 Score = 53.9 bits (128), Expect = 7e-06 Identities = 19/24 (79%), Positives = 23/24 (95%) Frame = +1 Query: 343 LPDHDITLEATWPELFIDHKGKYW 414 LP+HD+TLEA WPELF+DHKG+YW Sbjct: 175 LPEHDVTLEAAWPELFLDHKGRYW 198 >emb|CAN64366.1| hypothetical protein VITISV_031303 [Vitis vinifera] Length = 701 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = +1 Query: 340 ILPDHDITLEATWPELFIDHKGKYW 414 +LP HDITLEA WPELFIDHKG+YW Sbjct: 208 LLPFHDITLEAAWPELFIDHKGRYW 232