BLASTX nr result
ID: Rehmannia27_contig00027206
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00027206 (386 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087488.1| PREDICTED: nicotianamine synthase-like [Sesa... 54 3e-06 >ref|XP_011087488.1| PREDICTED: nicotianamine synthase-like [Sesamum indicum] Length = 322 Score = 54.3 bits (129), Expect = 3e-06 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%) Frame = -3 Query: 375 GPLMHCSKCAEIQSFNPI---GLIDELAVEEHLC 283 GPLM CSKCAEIQSFNP+ LI+EL VEEHLC Sbjct: 289 GPLMLCSKCAEIQSFNPLSQMNLIEELTVEEHLC 322