BLASTX nr result
ID: Rehmannia27_contig00027123
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00027123 (629 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097141.1| PREDICTED: ATP-dependent Clp protease proteo... 59 5e-07 >ref|XP_011097141.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit 3, chloroplastic-like [Sesamum indicum] Length = 323 Score = 58.9 bits (141), Expect = 5e-07 Identities = 33/71 (46%), Positives = 44/71 (61%), Gaps = 4/71 (5%) Frame = -3 Query: 402 EREDDYKIESPISIINN----QHTSSGRSKDNLRVKALNHXXXXXXXXXXXXXXSWLPRF 235 +R ++++ PI+ ++ Q+ S GRSK +LRVK+LNH SWLPRF Sbjct: 33 QRHNNFRHFFPITTTSSSWVGQNASCGRSKGSLRVKSLNHSLSSKWEVSNYAAPSWLPRF 92 Query: 234 EELDTTNMLLR 202 EELDTTNMLLR Sbjct: 93 EELDTTNMLLR 103