BLASTX nr result
ID: Rehmannia27_contig00026481
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00026481 (1674 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322815.1| hypothetical protein POPTR_0016s07700g [Popu... 53 9e-06 >ref|XP_002322815.1| hypothetical protein POPTR_0016s07700g [Populus trichocarpa] gi|222867445|gb|EEF04576.1| hypothetical protein POPTR_0016s07700g [Populus trichocarpa] Length = 63 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 12/43 (27%) Frame = -3 Query: 1669 MMTNSKACFSKHSQWPPK------------AFAFARLESLCCF 1577 MM N KACFSKHSQWP K AFAFA LESLCCF Sbjct: 1 MMINPKACFSKHSQWPSKLVSQNIRSGRLRAFAFAGLESLCCF 43