BLASTX nr result
ID: Rehmannia27_contig00026172
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00026172 (766 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086123.1| PREDICTED: SUN domain-containing protein 2-l... 55 1e-05 >ref|XP_011086123.1| PREDICTED: SUN domain-containing protein 2-like [Sesamum indicum] gi|747043886|ref|XP_011086132.1| PREDICTED: SUN domain-containing protein 2-like [Sesamum indicum] Length = 435 Score = 54.7 bits (130), Expect(2) = 1e-05 Identities = 34/63 (53%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Frame = +3 Query: 240 HEWPTTRRRAVEKNISAGDSVLTVGAIVTETKNRDA-LADDDMAATILLDARKTPSHIQA 416 ++ PTTRRRAVEKN G L A VT +N+DA L D AA IL DARKTP+ Q+ Sbjct: 11 NQGPTTRRRAVEKNPPTGGPDL-AAANVTVAENKDARLTAGDTAAAILRDARKTPAQTQS 69 Query: 417 RKS 425 +KS Sbjct: 70 KKS 72 Score = 22.7 bits (47), Expect(2) = 1e-05 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +1 Query: 214 MSASTVSITTNGPP 255 MSASTVS+T N P Sbjct: 1 MSASTVSVTANQGP 14