BLASTX nr result
ID: Rehmannia27_contig00026043
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00026043 (400 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012847053.1| PREDICTED: uncharacterized proline-rich prot... 70 1e-12 ref|XP_011070503.1| PREDICTED: formin-like protein 20 [Sesamum i... 68 1e-11 >ref|XP_012847053.1| PREDICTED: uncharacterized proline-rich protein [Erythranthe guttata] Length = 179 Score = 70.5 bits (171), Expect = 1e-12 Identities = 33/45 (73%), Positives = 39/45 (86%), Gaps = 1/45 (2%) Frame = -2 Query: 132 YVYNPGTAVPPPGMGQRNFSFPYYYFYASKASCYL-PLQEGFILL 1 YVYNPGT VPP MGQ+N+S+PYYYFY S+ASCY+ PL+ GFILL Sbjct: 126 YVYNPGTTVPPV-MGQQNYSYPYYYFYTSEASCYVRPLRWGFILL 169 >ref|XP_011070503.1| PREDICTED: formin-like protein 20 [Sesamum indicum] Length = 176 Score = 67.8 bits (164), Expect = 1e-11 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 1/45 (2%) Frame = -2 Query: 132 YVYNPGTAVPPPGMGQRNFSFPYYYFYASKASCYLP-LQEGFILL 1 YVYNPGT + PPGMGQRN+S+PYYYFYASKA LP L +G ILL Sbjct: 123 YVYNPGT-IMPPGMGQRNYSYPYYYFYASKAVSSLPLLDQGLILL 166