BLASTX nr result
ID: Rehmannia27_contig00026005
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00026005 (355 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094832.1| PREDICTED: pentatricopeptide repeat-containi... 64 1e-09 >ref|XP_011094832.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic [Sesamum indicum] gi|747094012|ref|XP_011094833.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic [Sesamum indicum] Length = 768 Score = 63.9 bits (154), Expect = 1e-09 Identities = 36/54 (66%), Positives = 36/54 (66%), Gaps = 5/54 (9%) Frame = +3 Query: 207 MAFSSCLKCLPCFPSHNLNHTLLCHQ-----KVTSFPFPRICVEQPSTLSIAVS 353 MAFSSCLKC P PSHN N L HQ KVTS PFPRI V QPS LS AVS Sbjct: 1 MAFSSCLKCHPWAPSHNPNLPFLFHQNSEPAKVTSLPFPRINVRQPSGLSCAVS 54