BLASTX nr result
ID: Rehmannia27_contig00025344
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00025344 (397 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012847569.1| PREDICTED: probable inactive purple acid pho... 56 1e-06 ref|XP_011075578.1| PREDICTED: probable inactive purple acid pho... 55 2e-06 >ref|XP_012847569.1| PREDICTED: probable inactive purple acid phosphatase 9 [Erythranthe guttata] gi|604316648|gb|EYU28840.1| hypothetical protein MIMGU_mgv1a002643mg [Erythranthe guttata] Length = 651 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -2 Query: 396 VLGAFLGYVLGFVSRSRRDGALGTRWTAVKSEE 298 VLGAFLGYV+GFVSRSRRD A +WTAVKSE+ Sbjct: 618 VLGAFLGYVVGFVSRSRRDAASEAKWTAVKSED 650 >ref|XP_011075578.1| PREDICTED: probable inactive purple acid phosphatase 2 [Sesamum indicum] Length = 660 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 396 VLGAFLGYVLGFVSRSRRDGALGTRWTAVKSEET 295 VLGAF+GYVLGF+SRSRR A +WTAVKS+ET Sbjct: 627 VLGAFIGYVLGFISRSRRSAATEAQWTAVKSDET 660