BLASTX nr result
ID: Rehmannia27_contig00025005
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00025005 (453 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098436.1| PREDICTED: galactinol--sucrose galactosyltra... 70 3e-11 ref|XP_012849778.1| PREDICTED: galactinol--sucrose galactosyltra... 69 5e-11 gb|AEP68101.1| raffinose synthase [Dorcoceras hygrometricum] 65 1e-09 emb|CDP02079.1| unnamed protein product [Coffea canephora] 55 3e-06 >ref|XP_011098436.1| PREDICTED: galactinol--sucrose galactosyltransferase [Sesamum indicum] Length = 784 Score = 69.7 bits (169), Expect = 3e-11 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = +3 Query: 225 MAPSLSKGGSNAAVLADGYTSSLITLDESNNFTVNDHVFLSEV 353 MAPSLSKGGSNA VL DG T SLITLD+S NFTVNDHVFL+EV Sbjct: 1 MAPSLSKGGSNATVLVDGVTDSLITLDDS-NFTVNDHVFLTEV 42 >ref|XP_012849778.1| PREDICTED: galactinol--sucrose galactosyltransferase [Erythranthe guttata] gi|848854782|ref|XP_012849786.1| PREDICTED: galactinol--sucrose galactosyltransferase [Erythranthe guttata] gi|604346316|gb|EYU44779.1| hypothetical protein MIMGU_mgv1a001601mg [Erythranthe guttata] Length = 787 Score = 69.3 bits (168), Expect = 5e-11 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = +3 Query: 225 MAPSLSKGGSNAAVLADGYTSSLITLDESNNFTVNDHVFLSEV 353 MAP+LSKG SNAA L DG+T+S++ LD+ +NFTVNDHVFLSEV Sbjct: 1 MAPNLSKGASNAAFLVDGFTTSIVNLDDESNFTVNDHVFLSEV 43 >gb|AEP68101.1| raffinose synthase [Dorcoceras hygrometricum] Length = 793 Score = 65.5 bits (158), Expect = 1e-09 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +3 Query: 225 MAPSLSKGGSNAAVLADGYTSSLITLDESNNFTVNDHVFLSEV 353 MAPSLSKG SNAA+LA+G+ SSLITLDE +N TVND V LS+V Sbjct: 1 MAPSLSKGDSNAAILANGFASSLITLDEKSNLTVNDQVVLSQV 43 >emb|CDP02079.1| unnamed protein product [Coffea canephora] Length = 781 Score = 55.5 bits (132), Expect = 3e-06 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = +3 Query: 225 MAPSLSKGGSNAAVLADGYTSSLITLDESNNFTVNDHVFLSEV 353 MAPSL KGGSN +VL DG SLI+LDES F VN+HV LSEV Sbjct: 1 MAPSLGKGGSNISVLVDGCNLSLISLDES-KFLVNNHVILSEV 42