BLASTX nr result
ID: Rehmannia27_contig00024444
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00024444 (1324 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076437.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-res... 64 6e-08 ref|XP_012858578.1| PREDICTED: ethylene-responsive transcription... 63 1e-07 gb|AID51422.1| ethylene response factor 17 [Diospyros kaki] 58 5e-06 >ref|XP_011076437.1| PREDICTED: LOW QUALITY PROTEIN: ethylene-responsive transcription factor 2-like [Sesamum indicum] Length = 240 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/48 (62%), Positives = 36/48 (75%) Frame = +1 Query: 847 FPHKAGANELEPVRVKAKRRSPEPTVSTASTVTFGSDSGSQKRIKKGE 990 FPHK G NE EPVRV AKR+SPEP+ STASTVT GS+ + ++K E Sbjct: 165 FPHKIGLNEPEPVRVTAKRKSPEPSASTASTVTSGSERKGKXAVEKAE 212 >ref|XP_012858578.1| PREDICTED: ethylene-responsive transcription factor 2-like [Erythranthe guttata] gi|604300331|gb|EYU20174.1| hypothetical protein MIMGU_mgv1a018364mg [Erythranthe guttata] Length = 243 Score = 62.8 bits (151), Expect = 1e-07 Identities = 32/49 (65%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = +1 Query: 847 FPHKAGANELEPVRVKAKRRSPEPTVSTASTVTFGSDSGSQ-KRIKKGE 990 FPHK G NE EPVR+ AKRRSPE + ST S +T GSDSGS KR+K+ E Sbjct: 160 FPHKIGLNEPEPVRITAKRRSPETSGSTVSALTSGSDSGSSPKRVKREE 208 >gb|AID51422.1| ethylene response factor 17 [Diospyros kaki] Length = 242 Score = 57.8 bits (138), Expect = 5e-06 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = +1 Query: 847 FPHKAGANELEPVRVKAKRRSPEPTVSTASTVTFGSDSGSQKRIKK 984 FPH+ G +E EPVR+ AKRRSPEPTVS +S+ SDSGS KR KK Sbjct: 166 FPHRIGLDEPEPVRITAKRRSPEPTVSGSSS---ASDSGSPKRRKK 208