BLASTX nr result
ID: Rehmannia27_contig00024251
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00024251 (659 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010110112.1| putative protein phosphatase 2C 8 [Morus not... 53 9e-07 >ref|XP_010110112.1| putative protein phosphatase 2C 8 [Morus notabilis] gi|587938469|gb|EXC25199.1| putative protein phosphatase 2C 8 [Morus notabilis] Length = 155 Score = 53.1 bits (126), Expect(2) = 9e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 429 HGVRLATEYAQKHLHKHVLSAGLPIELVCL 518 HG RLA EYAQKHLH +VLSAGLP ELVCL Sbjct: 116 HGGRLAAEYAQKHLHANVLSAGLPRELVCL 145 Score = 27.3 bits (59), Expect(2) = 9e-07 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 400 RCAHFAIYDG 429 RCAHFAIYDG Sbjct: 106 RCAHFAIYDG 115