BLASTX nr result
ID: Rehmannia27_contig00024043
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00024043 (834 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW76490.1| hypothetical protein EUGRSUZ_D00879 [Eucalyptus g... 54 9e-06 >gb|KCW76490.1| hypothetical protein EUGRSUZ_D00879 [Eucalyptus grandis] Length = 112 Score = 53.5 bits (127), Expect = 9e-06 Identities = 32/75 (42%), Positives = 40/75 (53%) Frame = +3 Query: 501 SIPPTSMGPAISGEAFGSISSPDINGNPGLTHVWNHGSDDDMSFAGGDVILGGFATALVA 680 S+ P ++ PA S GS + V H S + AGGDVILGGF ALV Sbjct: 38 SLHPPALSPAPSEGGIGSSVMTEAPVMRATRRVQRHHSS---TAAGGDVILGGFVMALVI 94 Query: 681 AIVCYIRITRKSKYS 725 ++CYIR+TRK K S Sbjct: 95 VVLCYIRVTRKRKES 109