BLASTX nr result
ID: Rehmannia27_contig00023875
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00023875 (1114 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011078167.1| PREDICTED: glyceraldehyde-3-phosphate dehydr... 59 3e-07 ref|XP_012846036.1| PREDICTED: chitin-binding lectin 1-like [Ery... 55 8e-06 >ref|XP_011078167.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, testis-specific-like [Sesamum indicum] Length = 138 Score = 58.9 bits (141), Expect = 3e-07 Identities = 26/43 (60%), Positives = 33/43 (76%), Gaps = 2/43 (4%) Frame = -1 Query: 364 YIFINGPPGNLYPVDAYYSGSGRSFSTGLVQFLI--VLGMIAF 242 Y+++NGPPGNLYPV YYSG RSFS G+ FLI +L ++AF Sbjct: 96 YVYVNGPPGNLYPVYPYYSGQARSFSMGITPFLISGILWLLAF 138 >ref|XP_012846036.1| PREDICTED: chitin-binding lectin 1-like [Erythranthe guttata] Length = 142 Score = 55.1 bits (131), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%), Gaps = 1/31 (3%) Frame = -1 Query: 364 YIFINGPPGNLYPVDAYYSGSGRSF-STGLV 275 YI+INGPPGNLYPVD +YSGSGRSF S GL+ Sbjct: 97 YIYINGPPGNLYPVDPFYSGSGRSFDSAGLM 127