BLASTX nr result
ID: Rehmannia27_contig00023716
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00023716 (914 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011013113.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 77 5e-12 dbj|BAB33421.1| putative senescence-associated protein [Pisum sa... 75 6e-12 gb|EJY66653.1| hypothetical protein OXYTRI_13058 [Oxytricha trif... 61 7e-07 gb|EJY65597.1| hypothetical protein OXYTRI_14248 [Oxytricha trif... 61 7e-07 emb|CDW75723.1| UNKNOWN [Stylonychia lemnae] 61 7e-07 ref|XP_001471493.1| hypothetical protein TTHERM_02141639 [Tetrah... 55 3e-06 gb|EMD30517.1| hypothetical protein CERSUDRAFT_109793 [Gelatopor... 49 3e-06 ref|XP_006678621.1| hypothetical protein BATDEDRAFT_87937 [Batra... 44 6e-06 >ref|XP_011013113.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105117228 [Populus euphratica] Length = 2627 Score = 77.0 bits (188), Expect = 5e-12 Identities = 35/53 (66%), Positives = 45/53 (84%) Frame = +1 Query: 373 ENKVAVNSWLPQTSYSCGNFYDTTSFKFQGLKDR*VTLSWFVFIV*IRIQRSF 531 ++ VA+N+WLPQ SY CGNF DT+SFKF+GLKDR TLS FVF++ IRI+R+F Sbjct: 1209 KSNVAMNAWLPQASYPCGNFSDTSSFKFKGLKDRXATLSRFVFVLEIRIKRAF 1261 >dbj|BAB33421.1| putative senescence-associated protein [Pisum sativum] Length = 282 Score = 74.7 bits (182), Expect = 6e-12 Identities = 34/53 (64%), Positives = 44/53 (83%) Frame = +1 Query: 373 ENKVAVNSWLPQTSYSCGNFYDTTSFKFQGLKDR*VTLSWFVFIV*IRIQRSF 531 ++ VA+N+WLPQ SY CGNF DT+SFKF+ LKDR TLS FVF++ IRI+R+F Sbjct: 101 KSNVAMNAWLPQASYPCGNFSDTSSFKFRSLKDRLATLSRFVFVLEIRIKRAF 153 >gb|EJY66653.1| hypothetical protein OXYTRI_13058 [Oxytricha trifallax] Length = 1367 Score = 61.2 bits (147), Expect = 7e-07 Identities = 28/53 (52%), Positives = 39/53 (73%) Frame = +1 Query: 373 ENKVAVNSWLPQTSYSCGNFYDTTSFKFQGLKDR*VTLSWFVFIV*IRIQRSF 531 ++ VA+N+WLPQ SY CGNF DT+S K KDR LS FVF++ I+I+++F Sbjct: 175 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKQKDRQAMLSQFVFVLKIKIKQAF 227 >gb|EJY65597.1| hypothetical protein OXYTRI_14248 [Oxytricha trifallax] Length = 1367 Score = 61.2 bits (147), Expect = 7e-07 Identities = 28/53 (52%), Positives = 39/53 (73%) Frame = +1 Query: 373 ENKVAVNSWLPQTSYSCGNFYDTTSFKFQGLKDR*VTLSWFVFIV*IRIQRSF 531 ++ VA+N+WLPQ SY CGNF DT+S K KDR LS FVF++ I+I+++F Sbjct: 175 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKQKDRQAMLSQFVFVLKIKIKQAF 227 >emb|CDW75723.1| UNKNOWN [Stylonychia lemnae] Length = 1881 Score = 61.2 bits (147), Expect = 7e-07 Identities = 28/53 (52%), Positives = 39/53 (73%) Frame = +1 Query: 373 ENKVAVNSWLPQTSYSCGNFYDTTSFKFQGLKDR*VTLSWFVFIV*IRIQRSF 531 ++ VA+N+WLPQ SY CGNF DT+S K KDR LS FVF++ I+I+++F Sbjct: 145 KSNVAMNAWLPQASYPCGNFSDTSSLKLLKQKDRQAMLSQFVFVLKIKIKQAF 197 >ref|XP_001471493.1| hypothetical protein TTHERM_02141639 [Tetrahymena thermophila SB210] gi|146141446|gb|EDK31198.1| hypothetical protein TTHERM_02141639 [Tetrahymena thermophila SB210] Length = 116 Score = 55.1 bits (131), Expect = 3e-06 Identities = 38/82 (46%), Positives = 47/82 (57%), Gaps = 5/82 (6%) Frame = -1 Query: 608 CLCQNNIMLVCQSVFKVFLS-----VHTKGLKLRWILIYTMNTNHESVT*RSFKPWNLKL 444 CL +N + Q+ +V LS K +K ILI++ NTN ESV RSF + KL Sbjct: 7 CLGRNACQTITQAS-QVQLSENGNLTQNKRVKATLILIFSRNTNRESVAYRSFNFTSFKL 65 Query: 443 VVS*KLPQE*LVCGSQEFTATL 378 VS KLPQ L CGSQEF +TL Sbjct: 66 EVSEKLPQGQLACGSQEFISTL 87 >gb|EMD30517.1| hypothetical protein CERSUDRAFT_109793 [Gelatoporia subvermispora B] Length = 126 Score = 48.9 bits (115), Expect(2) = 3e-06 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = +1 Query: 373 ENKVAVNSWLPQTSYSCGNFYDTTSFKFQGLK 468 ++ VA+N+WLPQ SY CGNF DT+S KF G K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSSLKFPGSK 42 Score = 30.8 bits (68), Expect(2) = 3e-06 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +3 Query: 456 PRFKRSLGYTFMVCIHSVN*N 518 P K S+G+TFMVCIH+ N N Sbjct: 39 PGSKGSIGHTFMVCIHTENQN 59 >ref|XP_006678621.1| hypothetical protein BATDEDRAFT_87937 [Batrachochytrium dendrobatidis JAM81] gi|328770529|gb|EGF80570.1| hypothetical protein BATDEDRAFT_87937 [Batrachochytrium dendrobatidis JAM81] Length = 111 Score = 44.3 bits (103), Expect(2) = 6e-06 Identities = 17/32 (53%), Positives = 24/32 (75%) Frame = +1 Query: 373 ENKVAVNSWLPQTSYSCGNFYDTTSFKFQGLK 468 ++ VA+N+WLPQ SY CGNF DT++ K+ K Sbjct: 11 KSNVAMNAWLPQASYPCGNFSDTSNLKYPEFK 42 Score = 34.7 bits (78), Expect(2) = 6e-06 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +3 Query: 456 PRFKRSLGYTFMVCIHSVN*N 518 P FK S+G+TFMVCIH+ N N Sbjct: 39 PEFKGSIGHTFMVCIHTENQN 59