BLASTX nr result
ID: Rehmannia27_contig00023484
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00023484 (785 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080942.1| PREDICTED: signal peptide peptidase-like 2 [... 70 2e-10 emb|CDP12033.1| unnamed protein product [Coffea canephora] 58 7e-07 >ref|XP_011080942.1| PREDICTED: signal peptide peptidase-like 2 [Sesamum indicum] Length = 542 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -1 Query: 128 MEFRRVWTLICICAALLMFLSSPVRVTAGDIVHDDDLAPKKP 3 M FRR+W+LIC+ AALL++LSSP VTAGDIVHDDD APKKP Sbjct: 1 MGFRRIWSLICVGAALLVWLSSPTGVTAGDIVHDDDSAPKKP 42 >emb|CDP12033.1| unnamed protein product [Coffea canephora] Length = 186 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -1 Query: 128 MEFRRVWTLICICAALLMFLSSPVRVTAGDIVHDDDLAPKKP 3 M F R+ +LIC+ A +++ SSP VTAGDIVH+DDLAPKKP Sbjct: 1 MGFDRICSLICVYAIVVVVFSSPAEVTAGDIVHEDDLAPKKP 42