BLASTX nr result
ID: Rehmannia27_contig00023470
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00023470 (394 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097049.1| PREDICTED: alternative NAD(P)H-ubiquinone ox... 55 2e-06 >ref|XP_011097049.1| PREDICTED: alternative NAD(P)H-ubiquinone oxidoreductase C1, chloroplastic/mitochondrial [Sesamum indicum] Length = 529 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/49 (57%), Positives = 34/49 (69%) Frame = +3 Query: 246 MAHAVSSLTSLKPFSREQFQWRNLFQQHSPKFWTNSGFFSSFTRRRGVR 392 MAHAVSSL SL FSR++ Q R Q HS K+WTNS +FSS +G+R Sbjct: 1 MAHAVSSLASLTLFSRQRLQRRKFAQPHSRKYWTNSRYFSSPGGSKGLR 49