BLASTX nr result
ID: Rehmannia27_contig00023204
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00023204 (721 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090158.1| PREDICTED: phytochromobilin:ferredoxin oxido... 72 2e-11 ref|XP_011090157.1| PREDICTED: phytochromobilin:ferredoxin oxido... 72 3e-11 ref|XP_012838429.1| PREDICTED: phytochromobilin:ferredoxin oxido... 65 6e-09 gb|KDO44942.1| hypothetical protein CISIN_1g0199442mg, partial [... 62 4e-08 ref|XP_006470729.1| PREDICTED: phytochromobilin:ferredoxin oxido... 62 4e-08 ref|XP_006446245.1| hypothetical protein CICLE_v10015899mg [Citr... 62 6e-08 ref|XP_006470728.1| PREDICTED: phytochromobilin:ferredoxin oxido... 62 6e-08 ref|XP_010277610.1| PREDICTED: phytochromobilin:ferredoxin oxido... 59 4e-07 gb|KJB83551.1| hypothetical protein B456_013G252400 [Gossypium r... 59 1e-06 gb|KHG12805.1| ferredoxin oxidoreductase, chloroplastic -like pr... 59 1e-06 ref|XP_012465156.1| PREDICTED: phytochromobilin:ferredoxin oxido... 59 1e-06 ref|XP_015062667.1| PREDICTED: phytochromobilin:ferredoxin oxido... 58 1e-06 ref|XP_010313054.1| PREDICTED: phytochromobilin synthase isoform... 58 1e-06 ref|XP_008227246.1| PREDICTED: phytochromobilin:ferredoxin oxido... 58 2e-06 ref|XP_007211577.1| hypothetical protein PRUPE_ppa008498mg [Prun... 58 2e-06 ref|XP_015062666.1| PREDICTED: phytochromobilin:ferredoxin oxido... 58 2e-06 ref|NP_001234133.2| phytochromobilin synthase [Solanum lycopersi... 58 2e-06 dbj|BAD93478.1| phytochromobilin synthase [Solanum lycopersicum]... 58 2e-06 ref|XP_010277609.1| PREDICTED: phytochromobilin:ferredoxin oxido... 57 2e-06 ref|XP_002278992.1| PREDICTED: phytochromobilin:ferredoxin oxido... 58 2e-06 >ref|XP_011090158.1| PREDICTED: phytochromobilin:ferredoxin oxidoreductase, chloroplastic isoform X2 [Sesamum indicum] Length = 314 Score = 72.0 bits (175), Expect = 2e-11 Identities = 36/39 (92%), Positives = 37/39 (94%), Gaps = 1/39 (2%) Frame = +3 Query: 18 DFL-SWLELMDQASGETDVSQIMLNLESQHRYLTWRAEK 131 D+L SWLELMDQAS ETDVSQIMLNLESQHRYLTWRAEK Sbjct: 198 DYLKSWLELMDQASMETDVSQIMLNLESQHRYLTWRAEK 236 >ref|XP_011090157.1| PREDICTED: phytochromobilin:ferredoxin oxidoreductase, chloroplastic isoform X1 [Sesamum indicum] Length = 340 Score = 72.0 bits (175), Expect = 3e-11 Identities = 36/39 (92%), Positives = 37/39 (94%), Gaps = 1/39 (2%) Frame = +3 Query: 18 DFL-SWLELMDQASGETDVSQIMLNLESQHRYLTWRAEK 131 D+L SWLELMDQAS ETDVSQIMLNLESQHRYLTWRAEK Sbjct: 224 DYLKSWLELMDQASMETDVSQIMLNLESQHRYLTWRAEK 262 >ref|XP_012838429.1| PREDICTED: phytochromobilin:ferredoxin oxidoreductase, chloroplastic [Erythranthe guttata] gi|604331075|gb|EYU35933.1| hypothetical protein MIMGU_mgv1a009348mg [Erythranthe guttata] Length = 345 Score = 65.5 bits (158), Expect = 6e-09 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 1/39 (2%) Frame = +3 Query: 18 DFL-SWLELMDQASGETDVSQIMLNLESQHRYLTWRAEK 131 D+L SWL+LMD+AS ETDVS+I LNLESQH+YLTWRAEK Sbjct: 229 DYLKSWLKLMDEASAETDVSRITLNLESQHKYLTWRAEK 267 >gb|KDO44942.1| hypothetical protein CISIN_1g0199442mg, partial [Citrus sinensis] Length = 261 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 21 FLSWLELMDQASGETDVSQIMLNLESQHRYLTWRAEK 131 + +WL+LMDQA ETDVSQIM N E+QHRYLTWRAEK Sbjct: 145 YKAWLKLMDQAVEETDVSQIMCNCEAQHRYLTWRAEK 181 >ref|XP_006470729.1| PREDICTED: phytochromobilin:ferredoxin oxidoreductase, chloroplastic isoform X2 [Citrus sinensis] Length = 272 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 21 FLSWLELMDQASGETDVSQIMLNLESQHRYLTWRAEK 131 + +WL+LMDQA ETDVSQIM N E+QHRYLTWRAEK Sbjct: 217 YKAWLKLMDQAVEETDVSQIMCNCEAQHRYLTWRAEK 253 >ref|XP_006446245.1| hypothetical protein CICLE_v10015899mg [Citrus clementina] gi|557548856|gb|ESR59485.1| hypothetical protein CICLE_v10015899mg [Citrus clementina] Length = 329 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 21 FLSWLELMDQASGETDVSQIMLNLESQHRYLTWRAEK 131 + +WL+LMDQA ETDVSQIM N E+QHRYLTWRAEK Sbjct: 217 YKAWLKLMDQAVEETDVSQIMCNCEAQHRYLTWRAEK 253 >ref|XP_006470728.1| PREDICTED: phytochromobilin:ferredoxin oxidoreductase, chloroplastic isoform X1 [Citrus sinensis] Length = 333 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 21 FLSWLELMDQASGETDVSQIMLNLESQHRYLTWRAEK 131 + +WL+LMDQA ETDVSQIM N E+QHRYLTWRAEK Sbjct: 217 YKAWLKLMDQAVEETDVSQIMCNCEAQHRYLTWRAEK 253 >ref|XP_010277610.1| PREDICTED: phytochromobilin:ferredoxin oxidoreductase, chloroplastic isoform X2 [Nelumbo nucifera] Length = 238 Score = 59.3 bits (142), Expect = 4e-07 Identities = 29/64 (45%), Positives = 37/64 (57%), Gaps = 8/64 (12%) Frame = +3 Query: 21 FLSWLELMDQASGETDVSQIMLNLESQHRYLTWRAEK--------VGTSIFSLMTFKSLY 176 + +WLELMDQAS E D SQ++ N E+QH+YL+WRAEK G TF + Sbjct: 141 YKAWLELMDQASEEMDASQVVCNREAQHKYLSWRAEKDLIRSFLFNGVDTLGSKTFLDYF 200 Query: 177 PLLW 188 P W Sbjct: 201 PEYW 204 >gb|KJB83551.1| hypothetical protein B456_013G252400 [Gossypium raimondii] Length = 307 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +3 Query: 21 FLSWLELMDQASGETDVSQIMLNLESQHRYLTWRAEK 131 + +WLELM+QA +TD SQI NLE+QHRYLTWRAEK Sbjct: 192 YKAWLELMEQAVEDTDPSQITCNLEAQHRYLTWRAEK 228 >gb|KHG12805.1| ferredoxin oxidoreductase, chloroplastic -like protein [Gossypium arboreum] Length = 312 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +3 Query: 21 FLSWLELMDQASGETDVSQIMLNLESQHRYLTWRAEK 131 + +WLELM+QA +TD SQI NLE+QHRYLTWRAEK Sbjct: 197 YKAWLELMEQAVEDTDPSQITCNLEAQHRYLTWRAEK 233 >ref|XP_012465156.1| PREDICTED: phytochromobilin:ferredoxin oxidoreductase, chloroplastic [Gossypium raimondii] gi|763816698|gb|KJB83550.1| hypothetical protein B456_013G252400 [Gossypium raimondii] Length = 336 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +3 Query: 21 FLSWLELMDQASGETDVSQIMLNLESQHRYLTWRAEK 131 + +WLELM+QA +TD SQI NLE+QHRYLTWRAEK Sbjct: 221 YKAWLELMEQAVEDTDPSQITCNLEAQHRYLTWRAEK 257 >ref|XP_015062667.1| PREDICTED: phytochromobilin:ferredoxin oxidoreductase, chloroplastic isoform X2 [Solanum pennellii] Length = 282 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = +3 Query: 3 AASRSDFLSWLELMDQASGETDVSQIMLNLESQHRYLTWRAEK 131 +A + + +WL LMD++ GETD SQI N E+QHRYLTWR+EK Sbjct: 160 SAFKDYYQAWLGLMDRSEGETDASQIACNCEAQHRYLTWRSEK 202 >ref|XP_010313054.1| PREDICTED: phytochromobilin synthase isoform X1 [Solanum lycopersicum] Length = 282 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = +3 Query: 3 AASRSDFLSWLELMDQASGETDVSQIMLNLESQHRYLTWRAEK 131 +A + + +WL LMD++ GETD SQI N E+QHRYLTWR+EK Sbjct: 160 SAFKDYYQAWLGLMDRSEGETDASQIACNCEAQHRYLTWRSEK 202 >ref|XP_008227246.1| PREDICTED: phytochromobilin:ferredoxin oxidoreductase, chloroplastic [Prunus mume] Length = 329 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +3 Query: 21 FLSWLELMDQASGETDVSQIMLNLESQHRYLTWRAEK 131 + +WLELMDQA ET+ S+IM N E+QHRYLTWRAEK Sbjct: 214 YKAWLELMDQAVVETNASKIMCNREAQHRYLTWRAEK 250 >ref|XP_007211577.1| hypothetical protein PRUPE_ppa008498mg [Prunus persica] gi|462407442|gb|EMJ12776.1| hypothetical protein PRUPE_ppa008498mg [Prunus persica] Length = 329 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +3 Query: 21 FLSWLELMDQASGETDVSQIMLNLESQHRYLTWRAEK 131 + +WLELMDQA ET+ S+IM N E+QHRYLTWRAEK Sbjct: 214 YKAWLELMDQAVVETNASKIMCNREAQHRYLTWRAEK 250 >ref|XP_015062666.1| PREDICTED: phytochromobilin:ferredoxin oxidoreductase, chloroplastic isoform X1 [Solanum pennellii] Length = 342 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = +3 Query: 3 AASRSDFLSWLELMDQASGETDVSQIMLNLESQHRYLTWRAEK 131 +A + + +WL LMD++ GETD SQI N E+QHRYLTWR+EK Sbjct: 220 SAFKDYYQAWLGLMDRSEGETDASQIACNCEAQHRYLTWRSEK 262 >ref|NP_001234133.2| phytochromobilin synthase [Solanum lycopersicum] Length = 342 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = +3 Query: 3 AASRSDFLSWLELMDQASGETDVSQIMLNLESQHRYLTWRAEK 131 +A + + +WL LMD++ GETD SQI N E+QHRYLTWR+EK Sbjct: 220 SAFKDYYQAWLGLMDRSEGETDASQIACNCEAQHRYLTWRSEK 262 >dbj|BAD93478.1| phytochromobilin synthase [Solanum lycopersicum] gi|62149358|dbj|BAD93479.1| phytochromobilin synthase [Solanum lycopersicum] Length = 342 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = +3 Query: 3 AASRSDFLSWLELMDQASGETDVSQIMLNLESQHRYLTWRAEK 131 +A + + +WL LMD++ GETD SQI N E+QHRYLTWR+EK Sbjct: 220 SAFKDYYQAWLGLMDRSEGETDASQIACNCEAQHRYLTWRSEK 262 >ref|XP_010277609.1| PREDICTED: phytochromobilin:ferredoxin oxidoreductase, chloroplastic isoform X1 [Nelumbo nucifera] gi|720070032|ref|XP_010277611.1| PREDICTED: phytochromobilin:ferredoxin oxidoreductase, chloroplastic isoform X1 [Nelumbo nucifera] Length = 255 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = +3 Query: 21 FLSWLELMDQASGETDVSQIMLNLESQHRYLTWRAEK 131 + +WLELMDQAS E D SQ++ N E+QH+YL+WRAEK Sbjct: 141 YKAWLELMDQASEEMDASQVVCNREAQHKYLSWRAEK 177 >ref|XP_002278992.1| PREDICTED: phytochromobilin:ferredoxin oxidoreductase, chloroplastic [Vitis vinifera] Length = 330 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +3 Query: 21 FLSWLELMDQASGETDVSQIMLNLESQHRYLTWRAEK 131 + +WLELM+QA+ E D SQI+ N E+QHRYLTWRAEK Sbjct: 208 YKAWLELMEQAAEERDTSQIICNREAQHRYLTWRAEK 244