BLASTX nr result
ID: Rehmannia27_contig00023171
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00023171 (4068 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011082711.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-... 73 1e-09 ref|XP_011082713.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-... 73 1e-09 ref|XP_012847908.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-... 65 5e-07 ref|XP_012827669.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-... 64 7e-07 >ref|XP_011082711.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like isoform X1 [Sesamum indicum] gi|747071660|ref|XP_011082712.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like isoform X2 [Sesamum indicum] Length = 457 Score = 73.2 bits (178), Expect = 1e-09 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -2 Query: 3731 SKNPFSIAFDAMYEQVETLLYGLKPDIVFYDFADWIPKLAPRL 3603 +KNP +IAFDA EQVET+L GLKPDIVFYDFADWIPK+A R+ Sbjct: 88 AKNPLAIAFDATAEQVETILSGLKPDIVFYDFADWIPKMAARV 130 >ref|XP_011082713.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like isoform X3 [Sesamum indicum] Length = 458 Score = 73.2 bits (178), Expect = 1e-09 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -2 Query: 3731 SKNPFSIAFDAMYEQVETLLYGLKPDIVFYDFADWIPKLAPRL 3603 +KNP +IAFDA EQVET+L GLKPDIVFYDFADWIPK+A R+ Sbjct: 88 AKNPLAIAFDATAEQVETILSGLKPDIVFYDFADWIPKMAARV 130 >ref|XP_012847908.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like [Erythranthe guttata] gi|604346533|gb|EYU44977.1| hypothetical protein MIMGU_mgv1a006277mg [Erythranthe guttata] Length = 450 Score = 64.7 bits (156), Expect = 5e-07 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -2 Query: 3731 SKNPFSIAFDAMYEQVETLLYGLKPDIVFYDFADWIPKLAPRL 3603 +K+P ++AFDAM +ETLL LKPDIVFYDFADWIP LA ++ Sbjct: 82 AKDPLAVAFDAMSGDIETLLQNLKPDIVFYDFADWIPALAAKI 124 >ref|XP_012827669.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like [Erythranthe guttata] gi|604299041|gb|EYU19000.1| hypothetical protein MIMGU_mgv1a021196mg [Erythranthe guttata] Length = 464 Score = 64.3 bits (155), Expect = 7e-07 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -2 Query: 3728 KNPFSIAFDAMYEQVETLLYGLKPDIVFYDFADWIPKLA 3612 KNP ++AFDAM EQVE LL L PDIVFYDFA WIP+LA Sbjct: 95 KNPLAVAFDAMSEQVEALLRSLNPDIVFYDFAHWIPRLA 133