BLASTX nr result
ID: Rehmannia27_contig00023160
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00023160 (653 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099164.1| PREDICTED: putative receptor-like protein ki... 57 6e-06 >ref|XP_011099164.1| PREDICTED: putative receptor-like protein kinase At5g39000 [Sesamum indicum] Length = 1220 Score = 56.6 bits (135), Expect = 6e-06 Identities = 40/91 (43%), Positives = 51/91 (56%) Frame = +2 Query: 2 QLELALEQQDNDNDQVVVLNEIASACDDIRPSNDEIYVSVNTVQSTMPSTDVQNLGYPSE 181 QLE +LEQQ++ Q + NE +S DI P +D+I V T Q TM STDVQNL P + Sbjct: 734 QLEFSLEQQESK--QPLKFNETSSFSVDIGPRDDKIDQFVKTGQLTMTSTDVQNLTPPRK 791 Query: 182 EQTNSQVASAGFPCVRGDERKSVILKPLRLF 274 EQ NS+V A R + KP RL+ Sbjct: 792 EQANSKVVIAEL----SSGRIATTYKPPRLW 818