BLASTX nr result
ID: Rehmannia27_contig00022202
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00022202 (1344 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099805.1| PREDICTED: uncharacterized protein LOC105178... 61 5e-07 gb|EYU43476.1| hypothetical protein MIMGU_mgv1a012049mg [Erythra... 60 5e-07 ref|XP_012829955.1| PREDICTED: uncharacterized protein LOC105951... 60 9e-07 >ref|XP_011099805.1| PREDICTED: uncharacterized protein LOC105178130 [Sesamum indicum] Length = 262 Score = 61.2 bits (147), Expect = 5e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 1243 QNYIRYAVRQKRADTKKALKNILFKGGCSTSKAE 1344 +NYIRYAVRQKRADTK+ALK+ILF GGCSTS+ E Sbjct: 57 KNYIRYAVRQKRADTKRALKSILFNGGCSTSRDE 90 >gb|EYU43476.1| hypothetical protein MIMGU_mgv1a012049mg [Erythranthe guttata] Length = 220 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 1243 QNYIRYAVRQKRADTKKALKNILFKGGCSTSKAE 1344 +NYIRYAVRQKR+D KKALK+ILF GGCSTS AE Sbjct: 59 KNYIRYAVRQKRSDAKKALKHILFNGGCSTSTAE 92 >ref|XP_012829955.1| PREDICTED: uncharacterized protein LOC105951109 [Erythranthe guttata] gi|604344780|gb|EYU43475.1| hypothetical protein MIMGU_mgv1a012049mg [Erythranthe guttata] Length = 263 Score = 60.5 bits (145), Expect = 9e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 1243 QNYIRYAVRQKRADTKKALKNILFKGGCSTSKAE 1344 +NYIRYAVRQKR+D KKALK+ILF GGCSTS AE Sbjct: 59 KNYIRYAVRQKRSDAKKALKHILFNGGCSTSTAE 92