BLASTX nr result
ID: Rehmannia27_contig00022109
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00022109 (462 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094980.1| PREDICTED: uncharacterized protein LOC105174... 58 4e-07 >ref|XP_011094980.1| PREDICTED: uncharacterized protein LOC105174543 [Sesamum indicum] Length = 526 Score = 58.2 bits (139), Expect = 4e-07 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 4/31 (12%) Frame = +1 Query: 1 AIWFWRKKRAQFLRPFQWLFRR----PAIEM 81 AIWFWRKKRAQFLRPFQWLFRR PAIEM Sbjct: 496 AIWFWRKKRAQFLRPFQWLFRRVFRAPAIEM 526