BLASTX nr result
ID: Rehmannia27_contig00021854
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00021854 (481 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012827474.1| PREDICTED: uncharacterized protein LOC105948... 76 4e-15 ref|XP_011097942.1| PREDICTED: uncharacterized protein LOC105176... 68 9e-12 gb|EYU19191.1| hypothetical protein MIMGU_mgv1a026444mg [Erythra... 59 1e-08 ref|XP_012841709.1| PREDICTED: uncharacterized protein LOC105961... 59 3e-08 >ref|XP_012827474.1| PREDICTED: uncharacterized protein LOC105948793 [Erythranthe guttata] Length = 120 Score = 76.3 bits (186), Expect = 4e-15 Identities = 48/74 (64%), Positives = 54/74 (72%), Gaps = 1/74 (1%) Frame = +1 Query: 58 PSLSSISEDDVLVAER-INNMDRPAGVWRRSFKRRVSSMSSRRDLARSLDYGDLRRGQQL 234 PSLSSISED+VLVAER INN +RPA WRRS K +VSS RR ARSLD +RR Q Sbjct: 52 PSLSSISEDNVLVAERIINNGERPAERWRRSLKGKVSSSVPRR--ARSLDNYPVRRTQ-- 107 Query: 235 SLMVPVFAPSPFMF 276 L++P FAP PFMF Sbjct: 108 -LIMPPFAPMPFMF 120 >ref|XP_011097942.1| PREDICTED: uncharacterized protein LOC105176742 [Sesamum indicum] Length = 129 Score = 67.8 bits (164), Expect = 9e-12 Identities = 41/75 (54%), Positives = 52/75 (69%), Gaps = 2/75 (2%) Frame = +1 Query: 58 PSLSSISEDDVLVAERINNMDRP--AGVWRRSFKRRVSSMSSRRDLARSLDYGDLRRGQQ 231 PSLSSISED LV ERI N +RP AG WRRS KR+V+++ S RD +RS D D R Sbjct: 58 PSLSSISEDS-LVVERIRNAERPNKAG-WRRSLKRKVAALRSERDRSRSFD-RDTDRQPP 114 Query: 232 LSLMVPVFAPSPFMF 276 +S ++P F+ +PFMF Sbjct: 115 VSALMPTFSATPFMF 129 >gb|EYU19191.1| hypothetical protein MIMGU_mgv1a026444mg [Erythranthe guttata] Length = 104 Score = 58.9 bits (141), Expect = 1e-08 Identities = 36/50 (72%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = +1 Query: 58 PSLSSISEDDVLVAER-INNMDRPAGVWRRSFKRRVSSMSSRRDLARSLD 204 PSLSSISED+VLVAER INN +RPA WRRS K +VSS RR ARSLD Sbjct: 52 PSLSSISEDNVLVAERIINNGERPAERWRRSLKGKVSSSVPRR--ARSLD 99 >ref|XP_012841709.1| PREDICTED: uncharacterized protein LOC105961994 [Erythranthe guttata] Length = 125 Score = 58.5 bits (140), Expect = 3e-08 Identities = 37/75 (49%), Positives = 50/75 (66%), Gaps = 2/75 (2%) Frame = +1 Query: 58 PSLSSISEDDVLVAERINNMDRP--AGVWRRSFKRRVSSMSSRRDLARSLDYGDLRRGQQ 231 PSL+ ISED V AE+ NN++R A WRR+ KR++SS+ S+RD RS D D R Sbjct: 54 PSLAPISED-VSTAEKANNVERTTAAAGWRRTLKRKISSV-SQRDRTRSSDC-DYGRRAP 110 Query: 232 LSLMVPVFAPSPFMF 276 L ++P F+P+PFMF Sbjct: 111 LPHVMPAFSPTPFMF 125