BLASTX nr result
ID: Rehmannia27_contig00021631
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00021631 (361 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012852542.1| PREDICTED: UPF0496 protein 1-like [Erythrant... 54 3e-06 >ref|XP_012852542.1| PREDICTED: UPF0496 protein 1-like [Erythranthe guttata] gi|604345807|gb|EYU44304.1| hypothetical protein MIMGU_mgv1a007475mg [Erythranthe guttata] Length = 406 Score = 54.3 bits (129), Expect = 3e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +2 Query: 2 CTQETRMARTLILRRIINYPSSGSSHDIGMFS 97 CTQETRMARTLILR+IIN+P SGS+ DIGMFS Sbjct: 376 CTQETRMARTLILRKIINHP-SGSNQDIGMFS 406