BLASTX nr result
ID: Rehmannia27_contig00021584
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00021584 (1458 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP61709.1| hypothetical protein KK1_016218 [Cajanus cajan] 58 4e-06 >gb|KYP61709.1| hypothetical protein KK1_016218 [Cajanus cajan] Length = 232 Score = 58.2 bits (139), Expect = 4e-06 Identities = 27/39 (69%), Positives = 29/39 (74%) Frame = +3 Query: 1296 GSFLITCPGRDLGFLHWVLDMYRCKRLPENVEATFMDGA 1412 G LITCPGRDLGFL+WV D RCKRL +VE TFM A Sbjct: 17 GILLITCPGRDLGFLYWVADASRCKRLLGSVEVTFMGEA 55