BLASTX nr result
ID: Rehmannia27_contig00021512
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00021512 (1153 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010107996.1| hypothetical protein L484_012352 [Morus nota... 70 7e-10 ref|XP_015389164.1| PREDICTED: probable membrane-associated kina... 70 1e-09 ref|XP_006419884.1| hypothetical protein CICLE_v10005353mg [Citr... 70 1e-09 ref|XP_015964763.1| PREDICTED: probable membrane-associated kina... 69 2e-09 ref|XP_012069586.1| PREDICTED: probable membrane-associated kina... 69 2e-09 ref|XP_009364217.1| PREDICTED: probable membrane-associated kina... 69 2e-09 ref|XP_008365975.1| PREDICTED: probable membrane-associated kina... 68 2e-09 ref|XP_002517210.1| PREDICTED: probable membrane-associated kina... 69 3e-09 ref|XP_007224857.1| hypothetical protein PRUPE_ppa022837mg [Prun... 69 3e-09 ref|XP_008222950.1| PREDICTED: probable membrane-associated kina... 69 3e-09 ref|XP_008383166.1| PREDICTED: probable membrane-associated kina... 68 4e-09 ref|XP_003610689.1| membrane-associated kinase regulator-like pr... 68 5e-09 emb|CDO99029.1| unnamed protein product [Coffea canephora] 67 7e-09 ref|XP_011021562.1| PREDICTED: probable membrane-associated kina... 67 7e-09 ref|XP_002314711.1| hypothetical protein POPTR_0010s10090g [Popu... 67 7e-09 ref|XP_011090751.1| PREDICTED: probable membrane-associated kina... 67 8e-09 ref|XP_008449937.1| PREDICTED: probable membrane-associated kina... 67 9e-09 ref|XP_004140153.1| PREDICTED: probable membrane-associated kina... 67 9e-09 ref|XP_010938531.1| PREDICTED: probable membrane-associated kina... 67 9e-09 ref|XP_015941411.1| PREDICTED: probable membrane-associated kina... 67 1e-08 >ref|XP_010107996.1| hypothetical protein L484_012352 [Morus notabilis] gi|587930442|gb|EXC17561.1| hypothetical protein L484_012352 [Morus notabilis] Length = 372 Score = 70.5 bits (171), Expect = 7e-10 Identities = 37/45 (82%), Positives = 39/45 (86%) Frame = +3 Query: 438 DFEFTISGASPRKSSGAAADLCPADEIFYKGQLLPLHISPRLSMV 572 DFEFTIS SPRKSS A LCPADE+FYKGQLLPLH+SPRLSMV Sbjct: 34 DFEFTIS-VSPRKSSNA---LCPADELFYKGQLLPLHLSPRLSMV 74 >ref|XP_015389164.1| PREDICTED: probable membrane-associated kinase regulator 1 [Citrus sinensis] Length = 336 Score = 69.7 bits (169), Expect = 1e-09 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 438 DFEFTISGASPRKSSGAAADLCPADEIFYKGQLLPLHISPRLSMV 572 DFEFTIS SPRKSS A LCPADE+FYKGQLLPLH+SPR+SMV Sbjct: 32 DFEFTIS-VSPRKSSSA---LCPADELFYKGQLLPLHLSPRISMV 72 >ref|XP_006419884.1| hypothetical protein CICLE_v10005353mg [Citrus clementina] gi|557521757|gb|ESR33124.1| hypothetical protein CICLE_v10005353mg [Citrus clementina] gi|641855904|gb|KDO74684.1| hypothetical protein CISIN_1g040164mg [Citrus sinensis] Length = 341 Score = 69.7 bits (169), Expect = 1e-09 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 438 DFEFTISGASPRKSSGAAADLCPADEIFYKGQLLPLHISPRLSMV 572 DFEFTIS SPRKSS A LCPADE+FYKGQLLPLH+SPR+SMV Sbjct: 32 DFEFTIS-VSPRKSSSA---LCPADELFYKGQLLPLHLSPRISMV 72 >ref|XP_015964763.1| PREDICTED: probable membrane-associated kinase regulator 1 [Arachis duranensis] Length = 367 Score = 69.3 bits (168), Expect = 2e-09 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 438 DFEFTISGASPRKSSGAAADLCPADEIFYKGQLLPLHISPRLSMV 572 DFEFTIS SPRKSS A LCPADE+FYKGQLLPLH+SPR+SMV Sbjct: 39 DFEFTIS-ISPRKSSAA---LCPADELFYKGQLLPLHLSPRISMV 79 >ref|XP_012069586.1| PREDICTED: probable membrane-associated kinase regulator 1 [Jatropha curcas] gi|643733201|gb|KDP40148.1| hypothetical protein JCGZ_02146 [Jatropha curcas] Length = 342 Score = 68.9 bits (167), Expect = 2e-09 Identities = 40/73 (54%), Positives = 45/73 (61%) Frame = +3 Query: 354 GQRRQKRXXXXXXXXXXXXXXXXXXXXXDFEFTISGASPRKSSGAAADLCPADEIFYKGQ 533 G+RR+K DFEFTIS SPRKSS A LCPADE+FYKGQ Sbjct: 2 GRRREKDSRSSQTLPSSPSHSFSSSSSSDFEFTIS-LSPRKSSTA---LCPADELFYKGQ 57 Query: 534 LLPLHISPRLSMV 572 LLPLH+SPR+SMV Sbjct: 58 LLPLHLSPRISMV 70 >ref|XP_009364217.1| PREDICTED: probable membrane-associated kinase regulator 1 [Pyrus x bretschneideri] Length = 402 Score = 69.3 bits (168), Expect = 2e-09 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 438 DFEFTISGASPRKSSGAAADLCPADEIFYKGQLLPLHISPRLSMV 572 DFEFTIS SPRKSS A LCPADE+FYKGQ+LPLH+SPRLSMV Sbjct: 49 DFEFTIS-LSPRKSSNA---LCPADELFYKGQILPLHLSPRLSMV 89 >ref|XP_008365975.1| PREDICTED: probable membrane-associated kinase regulator 1 [Malus domestica] Length = 288 Score = 68.2 bits (165), Expect = 2e-09 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 438 DFEFTISGASPRKSSGAAADLCPADEIFYKGQLLPLHISPRLSMV 572 DFEFTIS SPRKSS A +CPADE+FYKGQ+LPLH+SPRLSMV Sbjct: 50 DFEFTIS-LSPRKSSNA---VCPADELFYKGQILPLHLSPRLSMV 90 >ref|XP_002517210.1| PREDICTED: probable membrane-associated kinase regulator 1 [Ricinus communis] gi|223543845|gb|EEF45373.1| conserved hypothetical protein [Ricinus communis] Length = 350 Score = 68.6 bits (166), Expect = 3e-09 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 438 DFEFTISGASPRKSSGAAADLCPADEIFYKGQLLPLHISPRLSMV 572 DFEFTIS SPRKSS A LCPADE+FYKGQLLPLH+SPR+SMV Sbjct: 31 DFEFTIS-LSPRKSSTA---LCPADELFYKGQLLPLHLSPRISMV 71 >ref|XP_007224857.1| hypothetical protein PRUPE_ppa022837mg [Prunus persica] gi|462421793|gb|EMJ26056.1| hypothetical protein PRUPE_ppa022837mg [Prunus persica] Length = 391 Score = 68.6 bits (166), Expect = 3e-09 Identities = 36/45 (80%), Positives = 38/45 (84%) Frame = +3 Query: 438 DFEFTISGASPRKSSGAAADLCPADEIFYKGQLLPLHISPRLSMV 572 DFEFTIS SPRKSS LCPADE+FYKGQLLPLH+SPRLSMV Sbjct: 48 DFEFTIS-LSPRKSSNT---LCPADELFYKGQLLPLHLSPRLSMV 88 >ref|XP_008222950.1| PREDICTED: probable membrane-associated kinase regulator 1 [Prunus mume] Length = 393 Score = 68.6 bits (166), Expect = 3e-09 Identities = 36/45 (80%), Positives = 38/45 (84%) Frame = +3 Query: 438 DFEFTISGASPRKSSGAAADLCPADEIFYKGQLLPLHISPRLSMV 572 DFEFTIS SPRKSS LCPADE+FYKGQLLPLH+SPRLSMV Sbjct: 48 DFEFTIS-LSPRKSSNT---LCPADELFYKGQLLPLHLSPRLSMV 88 >ref|XP_008383166.1| PREDICTED: probable membrane-associated kinase regulator 1 [Malus domestica] Length = 393 Score = 68.2 bits (165), Expect = 4e-09 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 438 DFEFTISGASPRKSSGAAADLCPADEIFYKGQLLPLHISPRLSMV 572 DFEFTIS SPRKSS A +CPADE+FYKGQ+LPLH+SPRLSMV Sbjct: 50 DFEFTIS-LSPRKSSNA---VCPADELFYKGQILPLHLSPRLSMV 90 >ref|XP_003610689.1| membrane-associated kinase regulator-like protein, putative [Medicago truncatula] gi|355512024|gb|AES93647.1| membrane-associated kinase regulator-like protein, putative [Medicago truncatula] Length = 353 Score = 67.8 bits (164), Expect = 5e-09 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = +3 Query: 438 DFEFTISGASPRKSSGAAADLCPADEIFYKGQLLPLHISPRLSMV 572 DFEFTIS SPRKSS LCPADE+FYKGQLLPLH+SPR+SMV Sbjct: 42 DFEFTIS-ISPRKSSNT---LCPADELFYKGQLLPLHLSPRISMV 82 >emb|CDO99029.1| unnamed protein product [Coffea canephora] Length = 359 Score = 67.4 bits (163), Expect = 7e-09 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = +3 Query: 438 DFEFTISGASPRKSSGAAADLCPADEIFYKGQLLPLHISPRLSMV 572 DFEFTIS SPRK+S ++LCPADE+FYKGQLLPLH+SPR+SMV Sbjct: 29 DFEFTIS-LSPRKAS---SNLCPADELFYKGQLLPLHLSPRISMV 69 >ref|XP_011021562.1| PREDICTED: probable membrane-associated kinase regulator 1 [Populus euphratica] Length = 364 Score = 67.4 bits (163), Expect = 7e-09 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = +3 Query: 438 DFEFTISGASPRKSSGAAADLCPADEIFYKGQLLPLHISPRLSMV 572 DFEFTIS SPRKSS LCPADE+FYKGQLLPLH+SPR+SMV Sbjct: 31 DFEFTIS-LSPRKSS---TTLCPADELFYKGQLLPLHLSPRISMV 71 >ref|XP_002314711.1| hypothetical protein POPTR_0010s10090g [Populus trichocarpa] gi|222863751|gb|EEF00882.1| hypothetical protein POPTR_0010s10090g [Populus trichocarpa] Length = 365 Score = 67.4 bits (163), Expect = 7e-09 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = +3 Query: 438 DFEFTISGASPRKSSGAAADLCPADEIFYKGQLLPLHISPRLSMV 572 DFEFTIS SPRKSS LCPADE+FYKGQLLPLH+SPR+SMV Sbjct: 31 DFEFTIS-LSPRKSS---TTLCPADELFYKGQLLPLHLSPRISMV 71 >ref|XP_011090751.1| PREDICTED: probable membrane-associated kinase regulator 1 [Sesamum indicum] Length = 350 Score = 67.0 bits (162), Expect = 8e-09 Identities = 36/45 (80%), Positives = 38/45 (84%) Frame = +3 Query: 438 DFEFTISGASPRKSSGAAADLCPADEIFYKGQLLPLHISPRLSMV 572 DFEFTIS SPRKSS A LCPADE+FYKGQLLPLH+S RLSMV Sbjct: 34 DFEFTIS-ISPRKSSAA---LCPADELFYKGQLLPLHLSSRLSMV 74 >ref|XP_008449937.1| PREDICTED: probable membrane-associated kinase regulator 1 [Cucumis melo] Length = 355 Score = 67.0 bits (162), Expect = 9e-09 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 438 DFEFTISGASPRKSSGAAADLCPADEIFYKGQLLPLHISPRLSMV 572 DFEFTIS SPR++S A LCPADE+FYKGQLLPLH+SPRLSMV Sbjct: 29 DFEFTIS-VSPRQASTA---LCPADELFYKGQLLPLHLSPRLSMV 69 >ref|XP_004140153.1| PREDICTED: probable membrane-associated kinase regulator 1 [Cucumis sativus] gi|700192816|gb|KGN48020.1| hypothetical protein Csa_6G425080 [Cucumis sativus] Length = 360 Score = 67.0 bits (162), Expect = 9e-09 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 438 DFEFTISGASPRKSSGAAADLCPADEIFYKGQLLPLHISPRLSMV 572 DFEFTIS SPR++S A LCPADE+FYKGQLLPLH+SPRLSMV Sbjct: 30 DFEFTIS-VSPRQASTA---LCPADELFYKGQLLPLHLSPRLSMV 70 >ref|XP_010938531.1| PREDICTED: probable membrane-associated kinase regulator 1 [Elaeis guineensis] Length = 363 Score = 67.0 bits (162), Expect = 9e-09 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = +3 Query: 438 DFEFTISGASPRKSSGAAADLCPADEIFYKGQLLPLHISPRLSMV 572 DFEFT+S SP S AAA LCPADE+FYKGQLLPLH+SPRLSMV Sbjct: 35 DFEFTVS-LSP-SSRQAAAQLCPADELFYKGQLLPLHLSPRLSMV 77 >ref|XP_015941411.1| PREDICTED: probable membrane-associated kinase regulator 1 [Arachis duranensis] Length = 352 Score = 66.6 bits (161), Expect = 1e-08 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = +3 Query: 438 DFEFTISGASPRKSSGAAADLCPADEIFYKGQLLPLHISPRLSMV 572 DFEFTIS SPRKSS LCPADE+FYKGQLLPLH+SPR+SMV Sbjct: 37 DFEFTIS-ISPRKSSTL---LCPADELFYKGQLLPLHLSPRISMV 77