BLASTX nr result
ID: Rehmannia27_contig00021134
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00021134 (1043 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011093447.1| PREDICTED: benzoate carboxyl methyltransfera... 57 1e-05 >ref|XP_011093447.1| PREDICTED: benzoate carboxyl methyltransferase-like [Sesamum indicum] Length = 365 Score = 57.4 bits (137), Expect = 1e-05 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 940 QKTVISKTWPVLDETLKDMFTKNGFPKCMKIADL 1041 QK I K+W VLDETLKDMFT NGFPKC K+ADL Sbjct: 26 QKIGILKSWDVLDETLKDMFTANGFPKCFKMADL 59