BLASTX nr result
ID: Rehmannia27_contig00020671
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00020671 (2580 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075592.1| PREDICTED: 14-3-3-like protein GF14 iota [Se... 138 6e-33 ref|XP_012847623.1| PREDICTED: 14-3-3-like protein GF14 iota iso... 134 8e-32 ref|XP_012847622.1| PREDICTED: 14-3-3-like protein GF14 iota iso... 134 8e-32 ref|XP_012847621.1| PREDICTED: 14-3-3-like protein GF14 iota iso... 134 8e-32 ref|XP_015084999.1| PREDICTED: 14-3-3-like protein GF14 iota [So... 135 9e-32 ref|XP_006365133.1| PREDICTED: 14-3-3 protein 7-like [Solanum tu... 135 9e-32 ref|XP_004228408.1| PREDICTED: 14-3-3-like protein GF14 iota [So... 135 9e-32 emb|CDP00422.1| unnamed protein product [Coffea canephora] 132 3e-31 gb|AIJ04693.1| 14-3-3d [Morus alba var. atropurpurea] 132 5e-31 ref|XP_012855243.1| PREDICTED: 14-3-3-like protein GF14 iota iso... 131 9e-31 ref|XP_012855242.1| PREDICTED: 14-3-3-like protein GF14 iota iso... 131 1e-30 ref|XP_011070948.1| PREDICTED: 14-3-3-like protein GF14 iota [Se... 130 2e-30 emb|CBI27277.3| unnamed protein product [Vitis vinifera] 130 2e-30 ref|XP_002269100.1| PREDICTED: 14-3-3-like protein GF14 iota [Vi... 130 2e-30 ref|XP_010680716.1| PREDICTED: 14-3-3-like protein GF14 iota [Be... 130 2e-30 ref|XP_010066851.1| PREDICTED: 14-3-3-like protein GF14 iota [Eu... 130 3e-30 ref|XP_007227176.1| hypothetical protein PRUPE_ppa020788mg, part... 130 3e-30 ref|XP_008221499.1| PREDICTED: 14-3-3-like protein GF14 iota [Pr... 130 4e-30 ref|XP_015894964.1| PREDICTED: 14-3-3-like protein GF14 iota [Zi... 129 4e-30 gb|KJB59037.1| hypothetical protein B456_009G236300 [Gossypium r... 128 6e-30 >ref|XP_011075592.1| PREDICTED: 14-3-3-like protein GF14 iota [Sesamum indicum] Length = 265 Score = 138 bits (347), Expect = 6e-33 Identities = 69/81 (85%), Positives = 75/81 (92%) Frame = +3 Query: 1182 LYSVSYRNVVHARRASLRIVSLSEQKEESKGNENNVKLIKDYRQKVEDELSKICHDILSV 1361 L SV Y+NV+ ARRAS RI+S EQKEESKGNE+NVKLIKDYRQKVEDELSKIC+DILSV Sbjct: 53 LLSVGYKNVIGARRASWRIMSSIEQKEESKGNESNVKLIKDYRQKVEDELSKICYDILSV 112 Query: 1362 LDKHLIPSSGSGEATVFYYKM 1424 +DKHLIPSSGSGEATVFYYKM Sbjct: 113 IDKHLIPSSGSGEATVFYYKM 133 >ref|XP_012847623.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X3 [Erythranthe guttata] gi|604316663|gb|EYU28855.1| hypothetical protein MIMGU_mgv1a012202mg [Erythranthe guttata] Length = 257 Score = 134 bits (338), Expect = 8e-32 Identities = 68/81 (83%), Positives = 73/81 (90%) Frame = +3 Query: 1182 LYSVSYRNVVHARRASLRIVSLSEQKEESKGNENNVKLIKDYRQKVEDELSKICHDILSV 1361 L SV Y+NV+ ARRAS RI+S EQKEESKGNEN+VKLIK YRQKVEDELSKIC DILSV Sbjct: 47 LLSVGYKNVIGARRASWRIMSSIEQKEESKGNENHVKLIKGYRQKVEDELSKICQDILSV 106 Query: 1362 LDKHLIPSSGSGEATVFYYKM 1424 +DKHLIPSSGSGEATVFYYKM Sbjct: 107 IDKHLIPSSGSGEATVFYYKM 127 >ref|XP_012847622.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X2 [Erythranthe guttata] gi|604316662|gb|EYU28854.1| hypothetical protein MIMGU_mgv1a012202mg [Erythranthe guttata] Length = 258 Score = 134 bits (338), Expect = 8e-32 Identities = 68/81 (83%), Positives = 73/81 (90%) Frame = +3 Query: 1182 LYSVSYRNVVHARRASLRIVSLSEQKEESKGNENNVKLIKDYRQKVEDELSKICHDILSV 1361 L SV Y+NV+ ARRAS RI+S EQKEESKGNEN+VKLIK YRQKVEDELSKIC DILSV Sbjct: 47 LLSVGYKNVIGARRASWRIMSSIEQKEESKGNENHVKLIKGYRQKVEDELSKICQDILSV 106 Query: 1362 LDKHLIPSSGSGEATVFYYKM 1424 +DKHLIPSSGSGEATVFYYKM Sbjct: 107 IDKHLIPSSGSGEATVFYYKM 127 >ref|XP_012847621.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X1 [Erythranthe guttata] Length = 260 Score = 134 bits (338), Expect = 8e-32 Identities = 68/81 (83%), Positives = 73/81 (90%) Frame = +3 Query: 1182 LYSVSYRNVVHARRASLRIVSLSEQKEESKGNENNVKLIKDYRQKVEDELSKICHDILSV 1361 L SV Y+NV+ ARRAS RI+S EQKEESKGNEN+VKLIK YRQKVEDELSKIC DILSV Sbjct: 47 LLSVGYKNVIGARRASWRIMSSIEQKEESKGNENHVKLIKGYRQKVEDELSKICQDILSV 106 Query: 1362 LDKHLIPSSGSGEATVFYYKM 1424 +DKHLIPSSGSGEATVFYYKM Sbjct: 107 IDKHLIPSSGSGEATVFYYKM 127 >ref|XP_015084999.1| PREDICTED: 14-3-3-like protein GF14 iota [Solanum pennellii] Length = 274 Score = 135 bits (339), Expect = 9e-32 Identities = 66/81 (81%), Positives = 73/81 (90%) Frame = +3 Query: 1182 LYSVSYRNVVHARRASLRIVSLSEQKEESKGNENNVKLIKDYRQKVEDELSKICHDILSV 1361 L SV Y+NV+ ARRAS RI+S EQKEESKGNENNVKLIK YRQKVE+ELSKICHDIL + Sbjct: 47 LLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICHDILEI 106 Query: 1362 LDKHLIPSSGSGEATVFYYKM 1424 +DKHLIPSSG+GEATVFYYKM Sbjct: 107 IDKHLIPSSGTGEATVFYYKM 127 >ref|XP_006365133.1| PREDICTED: 14-3-3 protein 7-like [Solanum tuberosum] Length = 274 Score = 135 bits (339), Expect = 9e-32 Identities = 66/81 (81%), Positives = 73/81 (90%) Frame = +3 Query: 1182 LYSVSYRNVVHARRASLRIVSLSEQKEESKGNENNVKLIKDYRQKVEDELSKICHDILSV 1361 L SV Y+NV+ ARRAS RI+S EQKEESKGNENNVKLIK YRQKVE+ELSKICHDIL + Sbjct: 47 LLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICHDILEI 106 Query: 1362 LDKHLIPSSGSGEATVFYYKM 1424 +DKHLIPSSG+GEATVFYYKM Sbjct: 107 IDKHLIPSSGTGEATVFYYKM 127 >ref|XP_004228408.1| PREDICTED: 14-3-3-like protein GF14 iota [Solanum lycopersicum] Length = 274 Score = 135 bits (339), Expect = 9e-32 Identities = 66/81 (81%), Positives = 73/81 (90%) Frame = +3 Query: 1182 LYSVSYRNVVHARRASLRIVSLSEQKEESKGNENNVKLIKDYRQKVEDELSKICHDILSV 1361 L SV Y+NV+ ARRAS RI+S EQKEESKGNENNVKLIK YRQKVE+ELSKICHDIL + Sbjct: 47 LLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEEELSKICHDILEI 106 Query: 1362 LDKHLIPSSGSGEATVFYYKM 1424 +DKHLIPSSG+GEATVFYYKM Sbjct: 107 IDKHLIPSSGTGEATVFYYKM 127 >emb|CDP00422.1| unnamed protein product [Coffea canephora] Length = 253 Score = 132 bits (333), Expect = 3e-31 Identities = 66/81 (81%), Positives = 73/81 (90%) Frame = +3 Query: 1182 LYSVSYRNVVHARRASLRIVSLSEQKEESKGNENNVKLIKDYRQKVEDELSKICHDILSV 1361 L SV Y+NV+ ARRAS RI+S EQKEESKGNE+NVKLIK YRQKVEDELSKIC DIL++ Sbjct: 47 LLSVGYKNVIGARRASWRIMSSIEQKEESKGNEHNVKLIKGYRQKVEDELSKICSDILTI 106 Query: 1362 LDKHLIPSSGSGEATVFYYKM 1424 +DKHLIPSSGSGEATVFYYKM Sbjct: 107 IDKHLIPSSGSGEATVFYYKM 127 Score = 47.4 bits (111), Expect(2) = 8e-09 Identities = 28/42 (66%), Positives = 29/42 (69%) Frame = +2 Query: 2366 HLVKPNLFDEAIFELDILSKVSYKDITLITQLLAGNLTLSNS 2491 HL K FDEAI ELD LS+ SYKD TLI QLL NLTL S Sbjct: 202 HLAK-QAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTS 242 Score = 43.1 bits (100), Expect(2) = 8e-09 Identities = 37/111 (33%), Positives = 47/111 (42%) Frame = +3 Query: 1944 VIYQKLKFSMIDHDSYLTKFTIDQERKESTEQSLKGYEAC*ST*TE*LI*NKQNKLVKGF 2123 V Y K+K D+ YL +F DQ+RKE+ EQSLKGYEA F Sbjct: 122 VFYYKMKG---DYFRYLAEFKTDQDRKEAAEQSLKGYEA-------------------SF 159 Query: 2124 IMFLMSLIFSCSVGYFSHCKYRYPIDPPYPSWLDSKILLFLYYEIMNSPKR 2276 + S + + P P L +F YYEIMNSP+R Sbjct: 160 TLIAASATANTEL----------PSTHPIRLGLALNFSVF-YYEIMNSPER 199 >gb|AIJ04693.1| 14-3-3d [Morus alba var. atropurpurea] Length = 260 Score = 132 bits (332), Expect = 5e-31 Identities = 66/81 (81%), Positives = 72/81 (88%) Frame = +3 Query: 1182 LYSVSYRNVVHARRASLRIVSLSEQKEESKGNENNVKLIKDYRQKVEDELSKICHDILSV 1361 L SV Y+NV+ ARRAS RI+S EQKEESKGNENNVKLIK YRQKVEDELSKIC DIL++ Sbjct: 48 LLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEDELSKICSDILTI 107 Query: 1362 LDKHLIPSSGSGEATVFYYKM 1424 +DKHLIPSS SGEATVFYYKM Sbjct: 108 IDKHLIPSSASGEATVFYYKM 128 >ref|XP_012855243.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X2 [Erythranthe guttata] Length = 245 Score = 131 bits (329), Expect = 9e-31 Identities = 63/81 (77%), Positives = 74/81 (91%) Frame = +3 Query: 1182 LYSVSYRNVVHARRASLRIVSLSEQKEESKGNENNVKLIKDYRQKVEDELSKICHDILSV 1361 L SV Y+NV+ ARRAS RI+S EQKE+SKGNENNVK+IK+YR+KVE+EL+KICHDILSV Sbjct: 47 LLSVGYKNVIGARRASWRIMSSIEQKEDSKGNENNVKIIKNYRRKVEEELAKICHDILSV 106 Query: 1362 LDKHLIPSSGSGEATVFYYKM 1424 +DKHL+PSS SGEATVFYYKM Sbjct: 107 IDKHLLPSSASGEATVFYYKM 127 >ref|XP_012855242.1| PREDICTED: 14-3-3-like protein GF14 iota isoform X1 [Erythranthe guttata] gi|604302850|gb|EYU22375.1| hypothetical protein MIMGU_mgv1a012051mg [Erythranthe guttata] Length = 263 Score = 131 bits (329), Expect = 1e-30 Identities = 63/81 (77%), Positives = 74/81 (91%) Frame = +3 Query: 1182 LYSVSYRNVVHARRASLRIVSLSEQKEESKGNENNVKLIKDYRQKVEDELSKICHDILSV 1361 L SV Y+NV+ ARRAS RI+S EQKE+SKGNENNVK+IK+YR+KVE+EL+KICHDILSV Sbjct: 47 LLSVGYKNVIGARRASWRIMSSIEQKEDSKGNENNVKIIKNYRRKVEEELAKICHDILSV 106 Query: 1362 LDKHLIPSSGSGEATVFYYKM 1424 +DKHL+PSS SGEATVFYYKM Sbjct: 107 IDKHLLPSSASGEATVFYYKM 127 >ref|XP_011070948.1| PREDICTED: 14-3-3-like protein GF14 iota [Sesamum indicum] Length = 260 Score = 130 bits (328), Expect = 2e-30 Identities = 66/81 (81%), Positives = 71/81 (87%) Frame = +3 Query: 1182 LYSVSYRNVVHARRASLRIVSLSEQKEESKGNENNVKLIKDYRQKVEDELSKICHDILSV 1361 L SV Y+NV+ ARRAS RI+S EQKEESKGNE+NV LIK YRQKVEDELS ICHDILSV Sbjct: 47 LLSVGYKNVIGARRASWRIMSSIEQKEESKGNESNVNLIKGYRQKVEDELSNICHDILSV 106 Query: 1362 LDKHLIPSSGSGEATVFYYKM 1424 +DKHLIPSS SGEATVFYYKM Sbjct: 107 IDKHLIPSSRSGEATVFYYKM 127 >emb|CBI27277.3| unnamed protein product [Vitis vinifera] Length = 253 Score = 130 bits (327), Expect = 2e-30 Identities = 65/81 (80%), Positives = 72/81 (88%) Frame = +3 Query: 1182 LYSVSYRNVVHARRASLRIVSLSEQKEESKGNENNVKLIKDYRQKVEDELSKICHDILSV 1361 L SV Y+NV+ ARRAS RI+S EQKEESKGNE NVKLIK YRQKVE+ELSKIC DIL++ Sbjct: 35 LLSVGYKNVIGARRASWRIMSSIEQKEESKGNEQNVKLIKGYRQKVEEELSKICGDILTI 94 Query: 1362 LDKHLIPSSGSGEATVFYYKM 1424 +DKHLIPSSGSGEATVFYYKM Sbjct: 95 IDKHLIPSSGSGEATVFYYKM 115 Score = 48.1 bits (113), Expect(2) = 3e-10 Identities = 40/111 (36%), Positives = 49/111 (44%) Frame = +3 Query: 1944 VIYQKLKFSMIDHDSYLTKFTIDQERKESTEQSLKGYEAC*ST*TE*LI*NKQNKLVKGF 2123 V Y K+K D+ YL +F DQERKE++EQSLKGYEAC Sbjct: 110 VFYYKMKG---DYYRYLAEFKTDQERKEASEQSLKGYEAC-------------------- 146 Query: 2124 IMFLMSLIFSCSVGYFSHCKYRYPIDPPYPSWLDSKILLFLYYEIMNSPKR 2276 SL+ + S P P L +F YYEIMNSP+R Sbjct: 147 -----SLLAASST-----ANTDLPSTHPIRLGLALNFSVF-YYEIMNSPER 186 Score = 47.4 bits (111), Expect(2) = 3e-10 Identities = 28/42 (66%), Positives = 29/42 (69%) Frame = +2 Query: 2366 HLVKPNLFDEAIFELDILSKVSYKDITLITQLLAGNLTLSNS 2491 HL K FDEAI ELD LS+ SYKD TLI QLL NLTL S Sbjct: 189 HLAK-QAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTS 229 >ref|XP_002269100.1| PREDICTED: 14-3-3-like protein GF14 iota [Vitis vinifera] Length = 260 Score = 130 bits (327), Expect = 2e-30 Identities = 65/81 (80%), Positives = 72/81 (88%) Frame = +3 Query: 1182 LYSVSYRNVVHARRASLRIVSLSEQKEESKGNENNVKLIKDYRQKVEDELSKICHDILSV 1361 L SV Y+NV+ ARRAS RI+S EQKEESKGNE NVKLIK YRQKVE+ELSKIC DIL++ Sbjct: 47 LLSVGYKNVIGARRASWRIMSSIEQKEESKGNEQNVKLIKGYRQKVEEELSKICGDILTI 106 Query: 1362 LDKHLIPSSGSGEATVFYYKM 1424 +DKHLIPSSGSGEATVFYYKM Sbjct: 107 IDKHLIPSSGSGEATVFYYKM 127 Score = 46.2 bits (108), Expect(2) = 9e-06 Identities = 25/43 (58%), Positives = 30/43 (69%) Frame = +3 Query: 1944 VIYQKLKFSMIDHDSYLTKFTIDQERKESTEQSLKGYEAC*ST 2072 V Y K+K D+ YL +F DQERKE++EQSLKGYEA ST Sbjct: 122 VFYYKMKG---DYYRYLAEFKTDQERKEASEQSLKGYEAASST 161 Score = 33.9 bits (76), Expect(2) = 9e-06 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +1 Query: 2164 ATSATANTDIPSTLPIRLG 2220 A S+TANTD+PST PIRLG Sbjct: 157 AASSTANTDLPSTHPIRLG 175 >ref|XP_010680716.1| PREDICTED: 14-3-3-like protein GF14 iota [Beta vulgaris subsp. vulgaris] gi|870857402|gb|KMT08962.1| hypothetical protein BVRB_6g136750 [Beta vulgaris subsp. vulgaris] Length = 261 Score = 130 bits (327), Expect = 2e-30 Identities = 64/81 (79%), Positives = 71/81 (87%) Frame = +3 Query: 1182 LYSVSYRNVVHARRASLRIVSLSEQKEESKGNENNVKLIKDYRQKVEDELSKICHDILSV 1361 L SV Y+NV+ ARRAS RI+S EQKEESKGNENNVKLIK YRQKVEDELSKIC DIL++ Sbjct: 47 LLSVGYKNVIGARRASWRIMSSIEQKEESKGNENNVKLIKGYRQKVEDELSKICQDILAI 106 Query: 1362 LDKHLIPSSGSGEATVFYYKM 1424 +D HL+P SGSGEATVFYYKM Sbjct: 107 IDAHLVPHSGSGEATVFYYKM 127 >ref|XP_010066851.1| PREDICTED: 14-3-3-like protein GF14 iota [Eucalyptus grandis] gi|629099128|gb|KCW64893.1| hypothetical protein EUGRSUZ_G02455 [Eucalyptus grandis] Length = 259 Score = 130 bits (326), Expect = 3e-30 Identities = 63/81 (77%), Positives = 73/81 (90%) Frame = +3 Query: 1182 LYSVSYRNVVHARRASLRIVSLSEQKEESKGNENNVKLIKDYRQKVEDELSKICHDILSV 1361 L SV Y+NV+ ARRAS RI+S EQKEESKGNE+NVKL++DYRQKVE+ELSKIC DILS+ Sbjct: 47 LLSVGYKNVIGARRASWRIMSSIEQKEESKGNEHNVKLVRDYRQKVEEELSKICSDILSI 106 Query: 1362 LDKHLIPSSGSGEATVFYYKM 1424 +DKHLIPSS +GEATVFYYKM Sbjct: 107 IDKHLIPSSNAGEATVFYYKM 127 Score = 47.8 bits (112), Expect(2) = 9e-06 Identities = 26/43 (60%), Positives = 30/43 (69%) Frame = +3 Query: 1944 VIYQKLKFSMIDHDSYLTKFTIDQERKESTEQSLKGYEAC*ST 2072 V Y K+K D+ YL +F IDQERKE+ EQSLKGYEA ST Sbjct: 122 VFYYKMKG---DYYRYLAEFKIDQERKEAAEQSLKGYEAASST 161 Score = 32.3 bits (72), Expect(2) = 9e-06 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +1 Query: 2164 ATSATANTDIPSTLPIRLG 2220 A S+TANT++PST PIRLG Sbjct: 157 AASSTANTELPSTHPIRLG 175 >ref|XP_007227176.1| hypothetical protein PRUPE_ppa020788mg, partial [Prunus persica] gi|462424112|gb|EMJ28375.1| hypothetical protein PRUPE_ppa020788mg, partial [Prunus persica] Length = 262 Score = 130 bits (326), Expect = 3e-30 Identities = 65/81 (80%), Positives = 73/81 (90%) Frame = +3 Query: 1182 LYSVSYRNVVHARRASLRIVSLSEQKEESKGNENNVKLIKDYRQKVEDELSKICHDILSV 1361 L SV Y+NV+ ARRAS RI+S EQKEESKGNE+NVKLIK YRQKVE+ELSKIC+DILS+ Sbjct: 48 LLSVGYKNVIGARRASWRIMSSIEQKEESKGNEHNVKLIKGYRQKVEEELSKICNDILSI 107 Query: 1362 LDKHLIPSSGSGEATVFYYKM 1424 +DKHLIPSS SGEATVFYYKM Sbjct: 108 IDKHLIPSSTSGEATVFYYKM 128 >ref|XP_008221499.1| PREDICTED: 14-3-3-like protein GF14 iota [Prunus mume] Length = 263 Score = 130 bits (326), Expect = 4e-30 Identities = 65/81 (80%), Positives = 73/81 (90%) Frame = +3 Query: 1182 LYSVSYRNVVHARRASLRIVSLSEQKEESKGNENNVKLIKDYRQKVEDELSKICHDILSV 1361 L SV Y+NV+ ARRAS RI+S EQKEESKGNE+NVKLIK YRQKVE+ELSKIC+DILS+ Sbjct: 48 LLSVGYKNVIGARRASWRIMSSIEQKEESKGNEHNVKLIKGYRQKVEEELSKICNDILSI 107 Query: 1362 LDKHLIPSSGSGEATVFYYKM 1424 +DKHLIPSS SGEATVFYYKM Sbjct: 108 IDKHLIPSSTSGEATVFYYKM 128 >ref|XP_015894964.1| PREDICTED: 14-3-3-like protein GF14 iota [Ziziphus jujuba] Length = 234 Score = 129 bits (323), Expect = 4e-30 Identities = 64/81 (79%), Positives = 72/81 (88%) Frame = +3 Query: 1182 LYSVSYRNVVHARRASLRIVSLSEQKEESKGNENNVKLIKDYRQKVEDELSKICHDILSV 1361 L SV Y+NV+ ARRAS RI+S EQKEESKGNE+NVKLIK YRQKVEDELSKIC DIL++ Sbjct: 22 LLSVGYKNVIGARRASWRIMSSIEQKEESKGNEHNVKLIKGYRQKVEDELSKICGDILTI 81 Query: 1362 LDKHLIPSSGSGEATVFYYKM 1424 +DKHLIP+S SGEATVFYYKM Sbjct: 82 IDKHLIPASASGEATVFYYKM 102 >gb|KJB59037.1| hypothetical protein B456_009G236300 [Gossypium raimondii] Length = 221 Score = 128 bits (321), Expect = 6e-30 Identities = 63/81 (77%), Positives = 72/81 (88%) Frame = +3 Query: 1182 LYSVSYRNVVHARRASLRIVSLSEQKEESKGNENNVKLIKDYRQKVEDELSKICHDILSV 1361 L SV Y+NV+ ARRAS RI+S EQKEE+KGNE NVK IKDYRQ+VEDELSKIC+DILSV Sbjct: 13 LLSVGYKNVIGARRASWRILSSIEQKEEAKGNEQNVKRIKDYRQRVEDELSKICNDILSV 72 Query: 1362 LDKHLIPSSGSGEATVFYYKM 1424 +DKHLIPSS +GE+TVFYYKM Sbjct: 73 IDKHLIPSSSTGESTVFYYKM 93