BLASTX nr result
ID: Rehmannia27_contig00020469
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00020469 (1598 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094411.1| PREDICTED: PAN domain-containing protein At5... 79 3e-12 >ref|XP_011094411.1| PREDICTED: PAN domain-containing protein At5g03700 [Sesamum indicum] Length = 496 Score = 79.3 bits (194), Expect = 3e-12 Identities = 39/63 (61%), Positives = 48/63 (76%), Gaps = 2/63 (3%) Frame = +3 Query: 1416 MDRHKH-PHF-NSAVHLLLLTIFTALQTVTWTAHASDSPSPKELHIGFKVTPDPSISSFQ 1589 MDR + PHF N VHL LLT TALQ VTW++HA+ SPSP+EL +GF+ PD ++SSFQ Sbjct: 1 MDRRRQLPHFMNLPVHLFLLTFLTALQAVTWSSHAAHSPSPEELLLGFRAAPDSAVSSFQ 60 Query: 1590 PLL 1598 PLL Sbjct: 61 PLL 63