BLASTX nr result
ID: Rehmannia27_contig00020416
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00020416 (671 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088146.1| PREDICTED: probable sphingolipid transporter... 62 6e-08 >ref|XP_011088146.1| PREDICTED: probable sphingolipid transporter spinster homolog 2 [Sesamum indicum] Length = 531 Score = 62.4 bits (150), Expect = 6e-08 Identities = 32/50 (64%), Positives = 37/50 (74%) Frame = -2 Query: 151 NDASVPILKGGELSSREEVIVESPKPSRLGAFTVFGKDMKVLLLDKVYVV 2 N+ +PI+KG + S R EV ES KP L A TVFGKDMKVLLL+KVYVV Sbjct: 271 NECYIPIIKGAQPSGRVEVADESSKPLGLTALTVFGKDMKVLLLEKVYVV 320