BLASTX nr result
ID: Rehmannia27_contig00020382
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00020382 (913 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098248.1| PREDICTED: transcription factor GTE4-like is... 76 7e-12 ref|XP_011098247.1| PREDICTED: transcription factor GTE4-like is... 76 7e-12 ref|XP_011098246.1| PREDICTED: transcription factor GTE4-like is... 76 7e-12 ref|XP_012848080.1| PREDICTED: transcription factor GTE4-like [E... 61 6e-07 gb|EYU26344.1| hypothetical protein MIMGU_mgv1a017381mg [Erythra... 54 5e-06 >ref|XP_011098248.1| PREDICTED: transcription factor GTE4-like isoform X3 [Sesamum indicum] Length = 863 Score = 76.3 bits (186), Expect = 7e-12 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -1 Query: 589 MESGTIGEISDDLNWRRRCRWTENSKVYTRRIHKKAGKNSSDN 461 M SGT+G+ SDDLNWR RCRWTENSKVYTRR HKKA K+S++N Sbjct: 1 MASGTLGDSSDDLNWRGRCRWTENSKVYTRRFHKKAQKSSNNN 43 >ref|XP_011098247.1| PREDICTED: transcription factor GTE4-like isoform X2 [Sesamum indicum] Length = 876 Score = 76.3 bits (186), Expect = 7e-12 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -1 Query: 589 MESGTIGEISDDLNWRRRCRWTENSKVYTRRIHKKAGKNSSDN 461 M SGT+G+ SDDLNWR RCRWTENSKVYTRR HKKA K+S++N Sbjct: 1 MASGTLGDSSDDLNWRGRCRWTENSKVYTRRFHKKAQKSSNNN 43 >ref|XP_011098246.1| PREDICTED: transcription factor GTE4-like isoform X1 [Sesamum indicum] Length = 881 Score = 76.3 bits (186), Expect = 7e-12 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -1 Query: 589 MESGTIGEISDDLNWRRRCRWTENSKVYTRRIHKKAGKNSSDN 461 M SGT+G+ SDDLNWR RCRWTENSKVYTRR HKKA K+S++N Sbjct: 1 MASGTLGDSSDDLNWRGRCRWTENSKVYTRRFHKKAQKSSNNN 43 >ref|XP_012848080.1| PREDICTED: transcription factor GTE4-like [Erythranthe guttata] gi|604346561|gb|EYU45005.1| hypothetical protein MIMGU_mgv11b001319mg [Erythranthe guttata] Length = 782 Score = 61.2 bits (147), Expect = 6e-07 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = -1 Query: 589 MESGTIGEISDDLNWRRRCRWTENSKVYTRRIHKKAGKNSSDND 458 M+SG + SDDLNWR RCRW E+ KVYTRRI++K + S+++D Sbjct: 1 MDSGITRDSSDDLNWRERCRWNEHRKVYTRRINRKPNRTSNNSD 44 >gb|EYU26344.1| hypothetical protein MIMGU_mgv1a017381mg [Erythranthe guttata] Length = 78 Score = 53.5 bits (127), Expect = 5e-06 Identities = 26/46 (56%), Positives = 30/46 (65%) Frame = +1 Query: 457 YRYHCCFFRLSCGFFAYKLCYFRSIDISVSNSNHH*FPL*SPTPYM 594 Y YHC F RLS AY+L YF + + +SNSNHH PL SP PYM Sbjct: 33 YLYHCRFSRLSIDAAAYRLSYFPANETLLSNSNHHVNPLLSPKPYM 78