BLASTX nr result
ID: Rehmannia27_contig00020276
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia27_contig00020276 (574 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101628.1| PREDICTED: multiple myeloma tumor-associated... 64 4e-09 >ref|XP_011101628.1| PREDICTED: multiple myeloma tumor-associated protein 2 homolog [Sesamum indicum] Length = 216 Score = 63.5 bits (153), Expect = 4e-09 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -2 Query: 573 EVHGLGFARGPRSLEESNLPSGLKTESVENMNANMPTSSARN 448 +VHGLGF+RGPR EES++PS LK+E VENMN ++PT+SARN Sbjct: 125 QVHGLGFSRGPRPSEESSVPSILKSEPVENMNISVPTTSARN 166